Recombinant Burkholderia sp. Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Description

Molecular Definition and Production

Recombinant CrcB homolog is produced through heterologous expression in Escherichia coli, with modifications such as N-terminal His tags for purification . Key features include:

PropertyDetails
Source organismBurkholderia sp. (strain 383 / ATCC 17760)
Uniprot IDQ39IS2
Amino acid sequence length128 residues (full-length)
Expression systemE. coli with Tris-based storage buffer and 50% glycerol
Purity>90% (verified by SDS-PAGE)

The protein shares structural homology with fluoride transporters in Pseudomonas spp., featuring transmembrane domains critical for ion transport .

Primary Structure

The N-terminal sequence of Burkholderia CrcB begins with MFYSIVAIFVGAGLGALLRWFLSLALNEFFPAVPLGTLAANLIGGYVIGIAAVVFTTRVG..., highlighting conserved regions involved in fluoride resistance . Comparative analysis with E. coli CrcB (Uniprot ID: B7UKR6) reveals:

FeatureBurkholderia CrcB E. coli CrcB
Transmembrane helicesPredicted 4–5 alpha-helices5 confirmed alpha-helices
Conserved motifsLGALLRW, VIGIAAVVFTTRGSVARWLLSMR, FGWALLNVFVN
Subcellular localizationMembrane-associated Inner membrane

Functional Role

CrcB homologs mediate fluoride efflux via proton antiport mechanisms, protecting bacteria from fluoride toxicity . In Burkholderia, this protein is implicated in:

  • Stress adaptation: Enhanced survival in fluoride-rich environments .

  • Genetic regulation: Potential linkage to positively selected genes under evolutionary pressure in Bcc species .

Microbial Fluoride Resistance Studies

Recombinant CrcB is used to investigate fluoride transport kinetics. For example, Pseudomonas strains expressing crcB show 10–100× higher fluoride tolerance .

Diagnostic and Biotechnological Tools

  • ELISA kits: Commercial CrcB proteins (e.g., CSB-CF666476BAAK) serve as antigens for antibody detection .

  • Protein interaction studies: Used to identify binding partners in bacterial membrane complexes .

Evolutionary and Genomic Insights

Genomic analyses of Bcc species reveal:

  • Recombination events: 67% of core genome recombination occurs between Bcc species, influencing crcB diversification .

  • Positive selection: CrcB homologs cluster with genes under adaptive evolution in membrane transport (COG category P) .

Challenges and Future Directions

  • Functional redundancy: CrcB homologs in Burkholderia may overlap with other transporters (e.g., CLC F− antiporters) .

  • Structural studies: High-resolution crystallography is needed to map fluoride-binding sites.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type will be determined during production. If you require a specific tag type, please inform us and we will prioritize its inclusion in the development process.
Synonyms
crcB; Bcep18194_A4047; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Target Names
crcB
Target Protein Sequence
MFYSIVAIFVGAGLGALLRWFLSLALNEFFPAVPLGTLAANLIGGYVIGIAAVVFTTRVG LPPEWRLFVITGFLGGLTTFSTYSVEVMTHAVQGEFGWAFAVAALHLTGSFALTALGMWT ARAWLAAA
Uniprot No.

Target Background

Function
Important for reducing fluoride concentration in the cell, thereby mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of CrcB homolog in Burkholderia species?

The CrcB homolog in Burkholderia species is primarily implicated in fluoride ion channel activity and resistance mechanisms. This membrane protein belongs to a conserved family of fluoride ion channels that protect bacterial cells from fluoride toxicity. In Burkholderia, which inhabits diverse ecological niches including soil environments where fluoride compounds naturally occur, the CrcB homolog likely plays a critical protective role against environmental fluoride.

To investigate its specific function in Burkholderia, researchers typically employ gene knockout studies combined with growth assays under varying fluoride concentrations. Comparative genomic analysis, like those performed in Burkholderia cepacia complex (Bcc) studies, can reveal conservation patterns of the crcB gene across 116+ Burkholderia strains, providing insights into its evolutionary importance .

How is the crcB gene organized within the Burkholderia genome?

The crcB gene in Burkholderia species is typically found as a single-copy orthologous gene within the core genome. Based on comparative genomic analyses of Burkholderia species, core orthologous genes like crcB generally show specific patterns of organization and conservation. To determine its precise genomic context, researchers should:

  • Perform whole-genome sequencing of your specific Burkholderia strain

  • Conduct a genomic context analysis to identify neighboring genes and potential operons

  • Use bioinformatics tools such as the Prokaryotes promoter predictor from Berkeley Drosophila Genome Project to identify potential promoter regions

  • Map the transcript start sites using methods such as SMART RACE (rapid amplification of cDNA end) as described in Burkholderia studies

Orthologous gene analysis of 116 Burkholderia cepacia complex strains identified 1005 single-copy orthologous genes in the core genome, and genes like crcB would fall within specific Cluster of Orthologous Groups (COG) categories that show distinctive evolutionary properties .

What sequence homology does Burkholderia CrcB share with other bacterial species?

Burkholderia CrcB homologs typically share significant sequence conservation with other bacterial CrcB proteins, reflecting their essential function across prokaryotes. To determine specific homology relationships:

  • Extract the CrcB amino acid sequence from your Burkholderia strain

  • Perform multiple sequence alignment with CrcB proteins from diverse bacterial species

  • Calculate percent identity and similarity scores

  • Generate a phylogenetic tree to visualize evolutionary relationships

Evolutionary analysis techniques applied to Burkholderia core genes have revealed that approximately 5.8% of core orthologous genes show evidence of recombination, while about 1.1% demonstrate signs of positive selection . Understanding whether crcB falls into either category can provide insights into its evolutionary history and functional constraints.

What are the optimal conditions for expressing recombinant CrcB in Burkholderia expression systems?

For optimal expression of recombinant CrcB in Burkholderia, consider these methodological approaches:

  • Promoter selection: Utilize strong endogenous promoters identified through RNA-seq analysis. For example, Php173 from JP2-270 strain has been verified to significantly enhance gene expression across multiple developmental periods .

  • Expression vector design: Construct expression vectors similar to those used for other Burkholderia proteins:

    • For inducible expression, adapt systems like the pBLAC vector, which uses a lac promoter and lacI-encoded Lac repressor for IPTG-inducible gene expression

    • For constitutive expression, the shortened Php173 promoter (173 bp sequence) has demonstrated strong activity

  • Growth conditions: Cultivate in LB medium at 37°C with appropriate antibiotics selection. For Burkholderia pseudomallei-related strains, consider supplementation with adenine (Ade) when using attenuated laboratory strains .

  • Induction parameters: When using inducible systems, determine optimal IPTG concentration (typically 0.1-1.0 mM) and induction time through small-scale expression trials.

The strong endogenous promoter approach has successfully increased gene expression by 40-80 times for other genes in Burkholderia sp. JP2-270 , suggesting similar strategies would be effective for crcB expression.

How can I optimize codon usage for improved CrcB expression in heterologous systems?

To optimize codon usage for CrcB expression in heterologous systems:

  • Codon usage analysis:

    • Calculate the Codon Adaptation Index (CAI) of native crcB against the preferred codons of your expression host

    • Identify rare codons that might impede translation

  • Codon optimization strategy:

    • Replace rare codons with synonymous preferred codons of the expression host

    • Maintain important regulatory secondary structures in the mRNA

    • Avoid introducing unwanted regulatory elements or restriction sites

  • Experimental validation:

    • Compare expression levels between native and codon-optimized constructs

    • Measure mRNA levels using RT-qPCR with properly designed primers and probes (similar to methods used for sap1 gene in Burkholderia studies )

    • Validate protein production using Western blot or functional assays

  • Expression host considerations:

    • For E. coli expression, use strains supplemented with rare tRNAs if significant codon bias exists

    • For expression in other Burkholderia strains, analyze strain-specific codon preferences

When designing RT-qPCR primers for expression analysis, follow criteria used in Burkholderia studies: amplicon size of 60-100 bp, primer melting temperatures around 62°C with <4°C difference between pairs, and probe melting temperatures 5-10°C higher than corresponding primers .

What purification strategy yields the highest purity and stability for CrcB protein?

Developing an effective purification strategy for CrcB, a membrane protein, requires special considerations:

  • Solubilization optimization:

    • Test multiple detergents (DDM, LDAO, FC-12) at varying concentrations

    • Compare extraction efficiency through Western blot analysis

    • Assess protein stability in each detergent using thermal shift assays

  • Affinity chromatography:

    • Design constructs with appropriate tags (His6, FLAG, or Strep-tag II)

    • Optimize binding and elution conditions to maximize yield

    • Consider on-column detergent exchange if necessary

  • Size exclusion chromatography:

    • Separate aggregates, monomers, and oligomeric states

    • Analyze protein homogeneity through SDS-PAGE and native PAGE

    • Document elution profiles for quality control

  • Stability assessment:

    • Conduct time-course stability studies at different temperatures (4°C, -20°C, -80°C)

    • Test stabilizing additives (glycerol, specific lipids, cholesterol hemisuccinate)

    • Monitor functional activity over time using fluoride binding assays

DetergentWorking ConcentrationAdvantagesLimitations
DDM0.03-0.05%Mild, maintains activityLarger micelles
LDAO0.1-0.2%Smaller micellesMore harsh
FC-120.1-0.2%High extraction efficiencyPotential denaturation

When evaluating purification success, implement quality control measures similar to those used for other Burkholderia proteins, including functional assays specific to fluoride channel activity.

What experimental approaches best characterize CrcB channel function in Burkholderia?

To characterize CrcB channel function in Burkholderia, employ these methodological approaches:

  • Fluoride sensitivity assays:

    • Compare growth of wild-type and crcB knockout strains across a range of NaF concentrations

    • Measure IC50 values for fluoride inhibition

    • Conduct complementation studies with both native and mutant crcB variants

  • Electrophysiological measurements:

    • Reconstitute purified CrcB in liposomes or planar lipid bilayers

    • Perform patch-clamp recordings to measure fluoride conductance

    • Characterize channel kinetics, selectivity, and gating properties

  • Fluoride uptake assays:

    • Use fluoride-selective electrodes to measure fluoride influx/efflux in intact cells

    • Apply fluoride-sensitive fluorescent probes in real-time imaging

    • Compare transport rates between wild-type and mutant variants

  • Structural studies integration:

    • Correlate functional data with structural features determined by crystallography or cryo-EM

    • Identify key residues for mutagenesis through structure-guided approaches

    • Validate functional predictions through site-directed mutagenesis

Similar to the approach used for studying the sapR gene's role in virulence activation in Burkholderia , construct deletion mutants through allelic-replacement methods based on double homologous recombination. For complementation studies, employ the Tn7 integration system to ensure stable expression from a neutral chromosomal site .

How can I determine the membrane topology and structural features of CrcB?

To elucidate the membrane topology and structural features of Burkholderia CrcB:

  • Computational prediction:

    • Employ membrane protein topology prediction algorithms (TMHMM, Phobius)

    • Use homology modeling based on existing CrcB structures

    • Apply PSORTb V3.0 for subcellular localization prediction as used in Burkholderia studies

  • Biochemical topology mapping:

    • Perform cysteine accessibility scanning with membrane-permeable and impermeable reagents

    • Use reporter fusion constructs (PhoA, GFP) at predicted loop regions

    • Apply limited proteolysis to identify exposed regions

  • Structural biology approaches:

    • Pursue X-ray crystallography with purified, detergent-solubilized protein

    • Consider single-particle cryo-EM for structure determination

    • Employ hydrogen-deuterium exchange mass spectrometry to map dynamic regions

  • Molecular dynamics simulations:

    • Simulate CrcB within a lipid bilayer environment

    • Analyze protein stability, flexibility, and potential conformational changes

    • Identify water and ion pathways through the channel

The combination of computational and experimental approaches will provide a comprehensive understanding of CrcB's structural organization. For computational classification, use frameworks similar to those applied in the Burkholderia cepacia complex genomic analysis, which successfully categorized proteins based on structural and functional properties .

What protein-protein interactions does CrcB engage in within Burkholderia cells?

To identify and characterize protein-protein interactions involving CrcB in Burkholderia:

  • Co-immunoprecipitation (Co-IP):

    • Generate antibodies against CrcB or use epitope-tagged constructs

    • Perform pull-down experiments from solubilized membrane preparations

    • Identify interacting partners through mass spectrometry

  • Bacterial two-hybrid assays:

    • Screen for potential interactors using CrcB as bait

    • Validate positive hits through reverse two-hybrid and co-IP

    • Map interaction domains through truncation constructs

  • Proximity labeling techniques:

    • Express CrcB fused to BioID or APEX2 in Burkholderia

    • Identify proximal proteins through biotinylation and streptavidin pull-down

    • Distinguish direct interactors from neighboring proteins

  • Functional validation:

    • Generate knockout strains of identified interactors

    • Assess the impact on CrcB localization, stability, and function

    • Reconstruct key interactions in heterologous systems

When analyzing RNA-seq data to identify genes co-regulated with crcB, apply normalization methods similar to those used in Burkholderia studies, where genes with a false discovery rate (q-value) <0.01 were considered significantly differentially expressed . This approach can reveal functional associations through gene co-expression networks.

How can CRISPR-Cas9 genome editing be optimized for studying CrcB function in Burkholderia?

CRISPR-Cas9 genome editing in Burkholderia for CrcB functional studies requires specialized protocols:

  • Vector design considerations:

    • Select appropriate promoters for Cas9 and sgRNA expression in Burkholderia

    • Consider using the strong endogenous promoter Php173 identified in Burkholderia sp. JP2-270, which demonstrated robust expression capabilities

    • Design temperature-sensitive or counter-selectable vectors for transient Cas9 expression

  • sgRNA design strategy:

    • Target unique regions within crcB with minimal off-target potential

    • Account for Burkholderia's high GC content when designing guides

    • Validate sgRNA efficiency through in vitro cleavage assays

  • Homology-directed repair templates:

    • Design repair templates with 750-1000 bp homology arms

    • Include selectable markers flanked by FRT sites for subsequent removal

    • Consider silent mutations in the PAM site to prevent re-cutting

  • Transformation and screening:

    • Optimize electroporation parameters for Burkholderia (typically 2.5 kV, 200 Ω, 25 µF)

    • Implement a two-step selection strategy to identify edited clones

    • Verify edits through PCR, sequencing, and phenotypic assays

For clean deletions, adapt the allelic-replacement methodology based on double homologous recombination as described for sapR gene deletion in Burkholderia pseudomallei , which employs counter-selectable markers like pheS for resolving merodiploids.

What transcriptomic approaches can reveal CrcB regulation in response to environmental stressors?

To investigate CrcB regulation in response to environmental stressors:

  • RNA-seq experimental design:

    • Compare transcriptomes of Burkholderia under varying fluoride concentrations

    • Include additional stressors (pH shifts, osmotic stress, antimicrobials)

    • Sample at multiple time points to capture dynamic responses

  • Data processing and normalization:

    • Process raw sequencing data using tools specifically designed for bacterial RNA-seq, such as Rockhopper

    • Apply appropriate normalization methods to account for sequencing depth

    • Use stringent statistical thresholds (q-value <0.01) to identify significantly differentially expressed genes

  • Regulatory network analysis:

    • Identify co-regulated genes through clustering algorithms

    • Predict transcription factor binding sites in the crcB promoter region

    • Map regulatory interactions using network analysis tools

  • Validation experiments:

    • Confirm key findings through RT-qPCR following protocols established for Burkholderia genes

    • Perform promoter-reporter fusion assays to validate regulatory elements

    • Use chromatin immunoprecipitation to confirm transcription factor binding

When designing RT-qPCR validation experiments, select multiple housekeeping genes for normalization, as previously done in Burkholderia studies where three consistently expressed genes (BPSL0602, BPSL2502, and BPSS2061) were used across all experimental conditions .

How can molecular dynamics simulations enhance understanding of CrcB ion selectivity?

Molecular dynamics (MD) simulations provide valuable insights into CrcB ion selectivity mechanisms:

  • System preparation:

    • Build a CrcB homology model based on available crystal structures

    • Embed the protein in a realistic mixed-lipid bilayer mimicking Burkholderia membranes

    • Include explicit water molecules and physiologically relevant ion concentrations

  • Simulation protocols:

    • Perform equilibration runs (50-100 ns) to stabilize the system

    • Conduct production simulations (500+ ns) to observe ion permeation events

    • Apply electric fields to simulate membrane potential

  • Analysis of ion selectivity:

    • Calculate potential of mean force for F⁻ vs. Cl⁻ permeation

    • Identify key residues forming the selectivity filter

    • Characterize water coordination patterns during ion translocation

  • Validation through mutagenesis:

    • Design mutations of predicted key residues

    • Express mutants using established Burkholderia expression systems

    • Compare experimental ion selectivity with simulation predictions

Simulation TypeTimescalePrimary Information Obtained
Equilibrium MD100-1000 nsStable conformations, spontaneous ion movements
Steered MD10-100 nsEnergy barriers for ion translocation
Umbrella samplingCombined 100+ nsFree energy profiles for ion permeation
Flood simulations100-500 nsPreferred ion pathways through the channel

Similar computational approaches have been applied to analyze protein properties in Burkholderia species, including subcellular localization prediction and functional classification .

How can I address poor expression of CrcB in recombinant systems?

When facing challenges with CrcB expression in recombinant systems:

  • Promoter optimization:

    • Test alternative promoters with different strengths and induction characteristics

    • Consider the Php173 promoter identified in Burkholderia sp. JP2-270, which demonstrated strong expression capability across different growth phases

    • Evaluate the full-length promoter versus shortened versions (the 173 bp version of Php showed optimal activity)

  • Expression construct modifications:

    • Add fusion partners known to enhance membrane protein expression (MBP, SUMO)

    • Optimize the ribosome binding site and distance to start codon

    • Include purification tags at different positions (N-terminal, C-terminal, or in loops)

  • Expression conditions screening:

    • Test various induction temperatures (16°C, 25°C, 30°C, 37°C)

    • Evaluate different inducer concentrations in a systematic manner

    • Vary media composition to optimize protein folding and membrane integration

  • Host strain selection:

    • Compare expression in different E. coli strains (BL21, C41/C43, Lemo21)

    • Consider homologous expression in Burkholderia or related bacteria

    • Test specialized strains with enhanced membrane protein expression capability

Experimental evidence from Burkholderia studies shows that overexpression of certain genes using the Php173 promoter increased transcription levels by 40-80 times compared to wild-type expression , demonstrating the potential of proper promoter selection for enhancing recombinant protein production.

What strategies can overcome aggregation issues during CrcB purification?

To address CrcB aggregation during purification:

  • Solubilization optimization:

    • Screen multiple detergents individually and in combinations

    • Test lipid additives (POPC, POPE, cardiolipin) during solubilization

    • Evaluate different protein:detergent ratios systematically

  • Buffer optimization:

    • Screen pH ranges (typically pH 6.0-8.5 for membrane proteins)

    • Test various salt concentrations (150-500 mM NaCl)

    • Add stabilizing agents (glycerol 5-20%, cholesterol hemisuccinate)

  • Chromatography modifications:

    • Use slower flow rates during affinity chromatography

    • Consider on-column detergent exchange to milder alternatives

    • Implement a gel filtration polishing step immediately after affinity purification

  • Alternative approaches:

    • Test styrene-maleic acid lipid particles (SMALPs) for native membrane extraction

    • Consider nanodiscs or amphipols for improved stability

    • Explore the use of fusion partners with chaperone-like properties

AdditiveWorking ConcentrationMechanism of Action
Glycerol10-20%Prevents aggregation by excluding protein-protein interactions
Arginine50-200 mMSuppresses aggregation without interfering with protein-protein interactions
LMNG0.01-0.05%Forms smaller micelles than traditional detergents
GDN0.01-0.05%Stabilizes membrane proteins while maintaining native-like environment

When evaluating purification strategies, use analytical techniques similar to those applied in other Burkholderia protein studies to assess purity and homogeneity .

How can I differentiate between direct and indirect effects in CrcB knockout phenotypes?

Distinguishing direct from indirect effects in CrcB knockout phenotypes requires a multi-faceted approach:

  • Complementation strategies:

    • Restore wild-type phenotype with crcB expressed from a neutral chromosomal location

    • Use the Tn7 integration system successfully employed for complementation in Burkholderia studies

    • Include controls with inactive CrcB mutants to confirm specificity

  • Temporal analysis:

    • Implement inducible or repressible crcB expression systems

    • Track phenotypic changes across a time course following induction/repression

    • Identify primary versus secondary effects based on temporal appearance

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Apply network analysis to identify directly connected pathways

    • Use algorithms to distinguish immediate versus downstream effects

  • Targeted validation experiments:

    • Test specific hypotheses about direct CrcB functions

    • Design control experiments that can rule out alternative explanations

    • Use chemical genetics approaches with specific inhibitors when available

For complementation studies, follow the methodology used in Burkholderia pseudomallei research where genes and their native promoters were cloned into mini-Tn7-gat vectors and integrated into the chromosome at glmS sites . This approach ensures stable, single-copy complementation with physiological expression levels.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.