Recombinant CrcB homolog is produced through heterologous expression in Escherichia coli, with modifications such as N-terminal His tags for purification . Key features include:
The protein shares structural homology with fluoride transporters in Pseudomonas spp., featuring transmembrane domains critical for ion transport .
The N-terminal sequence of Burkholderia CrcB begins with MFYSIVAIFVGAGLGALLRWFLSLALNEFFPAVPLGTLAANLIGGYVIGIAAVVFTTRVG..., highlighting conserved regions involved in fluoride resistance . Comparative analysis with E. coli CrcB (Uniprot ID: B7UKR6) reveals:
CrcB homologs mediate fluoride efflux via proton antiport mechanisms, protecting bacteria from fluoride toxicity . In Burkholderia, this protein is implicated in:
Stress adaptation: Enhanced survival in fluoride-rich environments .
Genetic regulation: Potential linkage to positively selected genes under evolutionary pressure in Bcc species .
Recombinant CrcB is used to investigate fluoride transport kinetics. For example, Pseudomonas strains expressing crcB show 10–100× higher fluoride tolerance .
ELISA kits: Commercial CrcB proteins (e.g., CSB-CF666476BAAK) serve as antigens for antibody detection .
Protein interaction studies: Used to identify binding partners in bacterial membrane complexes .
Genomic analyses of Bcc species reveal:
Recombination events: 67% of core genome recombination occurs between Bcc species, influencing crcB diversification .
Positive selection: CrcB homologs cluster with genes under adaptive evolution in membrane transport (COG category P) .
KEGG: bur:Bcep18194_A4047
The CrcB homolog in Burkholderia species is primarily implicated in fluoride ion channel activity and resistance mechanisms. This membrane protein belongs to a conserved family of fluoride ion channels that protect bacterial cells from fluoride toxicity. In Burkholderia, which inhabits diverse ecological niches including soil environments where fluoride compounds naturally occur, the CrcB homolog likely plays a critical protective role against environmental fluoride.
To investigate its specific function in Burkholderia, researchers typically employ gene knockout studies combined with growth assays under varying fluoride concentrations. Comparative genomic analysis, like those performed in Burkholderia cepacia complex (Bcc) studies, can reveal conservation patterns of the crcB gene across 116+ Burkholderia strains, providing insights into its evolutionary importance .
The crcB gene in Burkholderia species is typically found as a single-copy orthologous gene within the core genome. Based on comparative genomic analyses of Burkholderia species, core orthologous genes like crcB generally show specific patterns of organization and conservation. To determine its precise genomic context, researchers should:
Perform whole-genome sequencing of your specific Burkholderia strain
Conduct a genomic context analysis to identify neighboring genes and potential operons
Use bioinformatics tools such as the Prokaryotes promoter predictor from Berkeley Drosophila Genome Project to identify potential promoter regions
Map the transcript start sites using methods such as SMART RACE (rapid amplification of cDNA end) as described in Burkholderia studies
Orthologous gene analysis of 116 Burkholderia cepacia complex strains identified 1005 single-copy orthologous genes in the core genome, and genes like crcB would fall within specific Cluster of Orthologous Groups (COG) categories that show distinctive evolutionary properties .
Burkholderia CrcB homologs typically share significant sequence conservation with other bacterial CrcB proteins, reflecting their essential function across prokaryotes. To determine specific homology relationships:
Extract the CrcB amino acid sequence from your Burkholderia strain
Perform multiple sequence alignment with CrcB proteins from diverse bacterial species
Calculate percent identity and similarity scores
Generate a phylogenetic tree to visualize evolutionary relationships
Evolutionary analysis techniques applied to Burkholderia core genes have revealed that approximately 5.8% of core orthologous genes show evidence of recombination, while about 1.1% demonstrate signs of positive selection . Understanding whether crcB falls into either category can provide insights into its evolutionary history and functional constraints.
For optimal expression of recombinant CrcB in Burkholderia, consider these methodological approaches:
Promoter selection: Utilize strong endogenous promoters identified through RNA-seq analysis. For example, Php173 from JP2-270 strain has been verified to significantly enhance gene expression across multiple developmental periods .
Expression vector design: Construct expression vectors similar to those used for other Burkholderia proteins:
Growth conditions: Cultivate in LB medium at 37°C with appropriate antibiotics selection. For Burkholderia pseudomallei-related strains, consider supplementation with adenine (Ade) when using attenuated laboratory strains .
Induction parameters: When using inducible systems, determine optimal IPTG concentration (typically 0.1-1.0 mM) and induction time through small-scale expression trials.
The strong endogenous promoter approach has successfully increased gene expression by 40-80 times for other genes in Burkholderia sp. JP2-270 , suggesting similar strategies would be effective for crcB expression.
To optimize codon usage for CrcB expression in heterologous systems:
Codon usage analysis:
Calculate the Codon Adaptation Index (CAI) of native crcB against the preferred codons of your expression host
Identify rare codons that might impede translation
Codon optimization strategy:
Replace rare codons with synonymous preferred codons of the expression host
Maintain important regulatory secondary structures in the mRNA
Avoid introducing unwanted regulatory elements or restriction sites
Experimental validation:
Expression host considerations:
For E. coli expression, use strains supplemented with rare tRNAs if significant codon bias exists
For expression in other Burkholderia strains, analyze strain-specific codon preferences
When designing RT-qPCR primers for expression analysis, follow criteria used in Burkholderia studies: amplicon size of 60-100 bp, primer melting temperatures around 62°C with <4°C difference between pairs, and probe melting temperatures 5-10°C higher than corresponding primers .
Developing an effective purification strategy for CrcB, a membrane protein, requires special considerations:
Solubilization optimization:
Test multiple detergents (DDM, LDAO, FC-12) at varying concentrations
Compare extraction efficiency through Western blot analysis
Assess protein stability in each detergent using thermal shift assays
Affinity chromatography:
Design constructs with appropriate tags (His6, FLAG, or Strep-tag II)
Optimize binding and elution conditions to maximize yield
Consider on-column detergent exchange if necessary
Size exclusion chromatography:
Separate aggregates, monomers, and oligomeric states
Analyze protein homogeneity through SDS-PAGE and native PAGE
Document elution profiles for quality control
Stability assessment:
Conduct time-course stability studies at different temperatures (4°C, -20°C, -80°C)
Test stabilizing additives (glycerol, specific lipids, cholesterol hemisuccinate)
Monitor functional activity over time using fluoride binding assays
| Detergent | Working Concentration | Advantages | Limitations |
|---|---|---|---|
| DDM | 0.03-0.05% | Mild, maintains activity | Larger micelles |
| LDAO | 0.1-0.2% | Smaller micelles | More harsh |
| FC-12 | 0.1-0.2% | High extraction efficiency | Potential denaturation |
When evaluating purification success, implement quality control measures similar to those used for other Burkholderia proteins, including functional assays specific to fluoride channel activity.
To characterize CrcB channel function in Burkholderia, employ these methodological approaches:
Fluoride sensitivity assays:
Compare growth of wild-type and crcB knockout strains across a range of NaF concentrations
Measure IC50 values for fluoride inhibition
Conduct complementation studies with both native and mutant crcB variants
Electrophysiological measurements:
Reconstitute purified CrcB in liposomes or planar lipid bilayers
Perform patch-clamp recordings to measure fluoride conductance
Characterize channel kinetics, selectivity, and gating properties
Fluoride uptake assays:
Use fluoride-selective electrodes to measure fluoride influx/efflux in intact cells
Apply fluoride-sensitive fluorescent probes in real-time imaging
Compare transport rates between wild-type and mutant variants
Structural studies integration:
Correlate functional data with structural features determined by crystallography or cryo-EM
Identify key residues for mutagenesis through structure-guided approaches
Validate functional predictions through site-directed mutagenesis
Similar to the approach used for studying the sapR gene's role in virulence activation in Burkholderia , construct deletion mutants through allelic-replacement methods based on double homologous recombination. For complementation studies, employ the Tn7 integration system to ensure stable expression from a neutral chromosomal site .
To elucidate the membrane topology and structural features of Burkholderia CrcB:
Computational prediction:
Biochemical topology mapping:
Perform cysteine accessibility scanning with membrane-permeable and impermeable reagents
Use reporter fusion constructs (PhoA, GFP) at predicted loop regions
Apply limited proteolysis to identify exposed regions
Structural biology approaches:
Pursue X-ray crystallography with purified, detergent-solubilized protein
Consider single-particle cryo-EM for structure determination
Employ hydrogen-deuterium exchange mass spectrometry to map dynamic regions
Molecular dynamics simulations:
Simulate CrcB within a lipid bilayer environment
Analyze protein stability, flexibility, and potential conformational changes
Identify water and ion pathways through the channel
The combination of computational and experimental approaches will provide a comprehensive understanding of CrcB's structural organization. For computational classification, use frameworks similar to those applied in the Burkholderia cepacia complex genomic analysis, which successfully categorized proteins based on structural and functional properties .
To identify and characterize protein-protein interactions involving CrcB in Burkholderia:
Co-immunoprecipitation (Co-IP):
Generate antibodies against CrcB or use epitope-tagged constructs
Perform pull-down experiments from solubilized membrane preparations
Identify interacting partners through mass spectrometry
Bacterial two-hybrid assays:
Screen for potential interactors using CrcB as bait
Validate positive hits through reverse two-hybrid and co-IP
Map interaction domains through truncation constructs
Proximity labeling techniques:
Express CrcB fused to BioID or APEX2 in Burkholderia
Identify proximal proteins through biotinylation and streptavidin pull-down
Distinguish direct interactors from neighboring proteins
Functional validation:
Generate knockout strains of identified interactors
Assess the impact on CrcB localization, stability, and function
Reconstruct key interactions in heterologous systems
When analyzing RNA-seq data to identify genes co-regulated with crcB, apply normalization methods similar to those used in Burkholderia studies, where genes with a false discovery rate (q-value) <0.01 were considered significantly differentially expressed . This approach can reveal functional associations through gene co-expression networks.
CRISPR-Cas9 genome editing in Burkholderia for CrcB functional studies requires specialized protocols:
Vector design considerations:
Select appropriate promoters for Cas9 and sgRNA expression in Burkholderia
Consider using the strong endogenous promoter Php173 identified in Burkholderia sp. JP2-270, which demonstrated robust expression capabilities
Design temperature-sensitive or counter-selectable vectors for transient Cas9 expression
sgRNA design strategy:
Target unique regions within crcB with minimal off-target potential
Account for Burkholderia's high GC content when designing guides
Validate sgRNA efficiency through in vitro cleavage assays
Homology-directed repair templates:
Design repair templates with 750-1000 bp homology arms
Include selectable markers flanked by FRT sites for subsequent removal
Consider silent mutations in the PAM site to prevent re-cutting
Transformation and screening:
Optimize electroporation parameters for Burkholderia (typically 2.5 kV, 200 Ω, 25 µF)
Implement a two-step selection strategy to identify edited clones
Verify edits through PCR, sequencing, and phenotypic assays
For clean deletions, adapt the allelic-replacement methodology based on double homologous recombination as described for sapR gene deletion in Burkholderia pseudomallei , which employs counter-selectable markers like pheS for resolving merodiploids.
To investigate CrcB regulation in response to environmental stressors:
RNA-seq experimental design:
Compare transcriptomes of Burkholderia under varying fluoride concentrations
Include additional stressors (pH shifts, osmotic stress, antimicrobials)
Sample at multiple time points to capture dynamic responses
Data processing and normalization:
Regulatory network analysis:
Identify co-regulated genes through clustering algorithms
Predict transcription factor binding sites in the crcB promoter region
Map regulatory interactions using network analysis tools
Validation experiments:
When designing RT-qPCR validation experiments, select multiple housekeeping genes for normalization, as previously done in Burkholderia studies where three consistently expressed genes (BPSL0602, BPSL2502, and BPSS2061) were used across all experimental conditions .
Molecular dynamics (MD) simulations provide valuable insights into CrcB ion selectivity mechanisms:
System preparation:
Build a CrcB homology model based on available crystal structures
Embed the protein in a realistic mixed-lipid bilayer mimicking Burkholderia membranes
Include explicit water molecules and physiologically relevant ion concentrations
Simulation protocols:
Perform equilibration runs (50-100 ns) to stabilize the system
Conduct production simulations (500+ ns) to observe ion permeation events
Apply electric fields to simulate membrane potential
Analysis of ion selectivity:
Calculate potential of mean force for F⁻ vs. Cl⁻ permeation
Identify key residues forming the selectivity filter
Characterize water coordination patterns during ion translocation
Validation through mutagenesis:
Design mutations of predicted key residues
Express mutants using established Burkholderia expression systems
Compare experimental ion selectivity with simulation predictions
| Simulation Type | Timescale | Primary Information Obtained |
|---|---|---|
| Equilibrium MD | 100-1000 ns | Stable conformations, spontaneous ion movements |
| Steered MD | 10-100 ns | Energy barriers for ion translocation |
| Umbrella sampling | Combined 100+ ns | Free energy profiles for ion permeation |
| Flood simulations | 100-500 ns | Preferred ion pathways through the channel |
Similar computational approaches have been applied to analyze protein properties in Burkholderia species, including subcellular localization prediction and functional classification .
When facing challenges with CrcB expression in recombinant systems:
Promoter optimization:
Test alternative promoters with different strengths and induction characteristics
Consider the Php173 promoter identified in Burkholderia sp. JP2-270, which demonstrated strong expression capability across different growth phases
Evaluate the full-length promoter versus shortened versions (the 173 bp version of Php showed optimal activity)
Expression construct modifications:
Add fusion partners known to enhance membrane protein expression (MBP, SUMO)
Optimize the ribosome binding site and distance to start codon
Include purification tags at different positions (N-terminal, C-terminal, or in loops)
Expression conditions screening:
Test various induction temperatures (16°C, 25°C, 30°C, 37°C)
Evaluate different inducer concentrations in a systematic manner
Vary media composition to optimize protein folding and membrane integration
Host strain selection:
Compare expression in different E. coli strains (BL21, C41/C43, Lemo21)
Consider homologous expression in Burkholderia or related bacteria
Test specialized strains with enhanced membrane protein expression capability
Experimental evidence from Burkholderia studies shows that overexpression of certain genes using the Php173 promoter increased transcription levels by 40-80 times compared to wild-type expression , demonstrating the potential of proper promoter selection for enhancing recombinant protein production.
To address CrcB aggregation during purification:
Solubilization optimization:
Screen multiple detergents individually and in combinations
Test lipid additives (POPC, POPE, cardiolipin) during solubilization
Evaluate different protein:detergent ratios systematically
Buffer optimization:
Screen pH ranges (typically pH 6.0-8.5 for membrane proteins)
Test various salt concentrations (150-500 mM NaCl)
Add stabilizing agents (glycerol 5-20%, cholesterol hemisuccinate)
Chromatography modifications:
Use slower flow rates during affinity chromatography
Consider on-column detergent exchange to milder alternatives
Implement a gel filtration polishing step immediately after affinity purification
Alternative approaches:
Test styrene-maleic acid lipid particles (SMALPs) for native membrane extraction
Consider nanodiscs or amphipols for improved stability
Explore the use of fusion partners with chaperone-like properties
| Additive | Working Concentration | Mechanism of Action |
|---|---|---|
| Glycerol | 10-20% | Prevents aggregation by excluding protein-protein interactions |
| Arginine | 50-200 mM | Suppresses aggregation without interfering with protein-protein interactions |
| LMNG | 0.01-0.05% | Forms smaller micelles than traditional detergents |
| GDN | 0.01-0.05% | Stabilizes membrane proteins while maintaining native-like environment |
When evaluating purification strategies, use analytical techniques similar to those applied in other Burkholderia protein studies to assess purity and homogeneity .
Distinguishing direct from indirect effects in CrcB knockout phenotypes requires a multi-faceted approach:
Complementation strategies:
Temporal analysis:
Implement inducible or repressible crcB expression systems
Track phenotypic changes across a time course following induction/repression
Identify primary versus secondary effects based on temporal appearance
Multi-omics integration:
Combine transcriptomics, proteomics, and metabolomics data
Apply network analysis to identify directly connected pathways
Use algorithms to distinguish immediate versus downstream effects
Targeted validation experiments:
Test specific hypotheses about direct CrcB functions
Design control experiments that can rule out alternative explanations
Use chemical genetics approaches with specific inhibitors when available
For complementation studies, follow the methodology used in Burkholderia pseudomallei research where genes and their native promoters were cloned into mini-Tn7-gat vectors and integrated into the chromosome at glmS sites . This approach ensures stable, single-copy complementation with physiological expression levels.