Bcep18194_A4425 is a membrane protein belonging to the UPF0060 family that has been identified in Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383), formerly classified as Burkholderia cepacia (strain ATCC 17760 / NCIB 9086 / R18194) . The UPF (Uncharacterized Protein Family) designation indicates that the function of this protein family has not been fully elucidated, though recent research suggests potential roles in membrane transport processes.
The recombinant version of Bcep18194_A4425 refers specifically to the protein that has been expressed in a non-native host organism (typically E. coli) with added features such as histidine tags to facilitate purification and study . This recombinant production enables researchers to investigate the protein's properties and functions in controlled laboratory settings.
Burkholderia species comprise a diverse group of gram-negative bacteria found in various environmental niches including soil, water, and plant rhizospheres. Some species are known pathogens, while others have beneficial applications in areas such as bioremediation and biocontrol . Within this genus, the Burkholderia pseudomallei complex (Bpc) has received particular attention due to its inclusion of several clinically significant species . Understanding membrane proteins like Bcep18194_A4425 is essential for deciphering bacterial physiology, environmental adaptations, and potentially pathogenic mechanisms.
The recombinant form of Bcep18194_A4425 protein is predominantly expressed in Escherichia coli expression systems, which provide a reliable and efficient platform for producing bacterial proteins in research quantities . For optimal purification and detection, the protein is typically fused to an N-terminal histidine tag (His-tag), enabling efficient isolation using metal affinity chromatography techniques.
Commercial preparations of this recombinant protein contain the full-length sequence (amino acids 1-110) with the additional His-tag, ensuring that the entire native protein structure is preserved . After expression and purification, the protein generally achieves greater than 90% purity as determined by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) analysis .
The purified recombinant protein is typically provided in lyophilized powder form, suspended in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . This formulation is designed to enhance stability during storage and shipping while maintaining the protein's native conformation and biological activity.
While the precise biological function of Bcep18194_A4425 remains to be fully characterized, several lines of evidence provide insights into its potential roles:
According to the KEGG database, Bcep18194_A4425 is associated with K09771 classification, which corresponds to small multidrug resistance family-3 protein . This classification suggests a potential involvement in drug resistance mechanisms, possibly through efflux of antimicrobial compounds or other toxic substances.
Notably, recent comprehensive studies on protein functions across diverse bacteria have proposed that UPF0060-containing proteins may function specifically as thallium-specific efflux pumps . This finding suggests a specialized role in metal ion transport and cellular detoxification processes, which would be particularly relevant given the toxicity of thallium to bacterial cells.
As an integral membrane protein, Bcep18194_A4425 likely participates in crucial cellular processes at the membrane interface. These could include various transport functions, maintenance of membrane integrity, or signal transduction mechanisms that allow the bacterium to respond to environmental changes.
The evolutionary conservation of UPF0060 proteins across multiple bacterial species further indicates they perform important functions in bacterial physiology. This conservation pattern is characteristic of proteins involved in fundamental cellular processes, though specific functions may have diverged between different bacterial lineages during evolution.
Several related UPF0060 membrane proteins have been identified in other Burkholderia species, allowing for comparative analysis that may provide additional functional insights. Notable examples include:
Burkholderia pseudomallei UPF0060 membrane protein BURPS668_1464, a 110-amino acid protein with similar structural features
Burkholderia mallei UPF0060 membrane protein BMA0761, another closely related member of this protein family
Table 2: Comparison of Bcep18194_A4425 with Other Burkholderia UPF0060 Membrane Proteins
| Protein | Species | Length (aa) | Amino Acid Sequence |
|---|---|---|---|
| Bcep18194_A4425 | Burkholderia lata | 110 | MTELMRIAALFAATALAEIVGCYLPWLVLKEGRPVWLLVPAALSLALFAWLLTLHPSAAGRTYAAYGGVYIAVALVWLRVVDGVALTRWDVAGAVLALGGMAVIALQPRA |
| BURPS668_1464 | Burkholderia pseudomallei | 110 | MLSLAKIAALFVLTAVAEIVGCYLPWLVLKAGKPAWLLAPAALSLALFAWLLTLHPAAAARTYAAYGGVYIAVALAWLRIVDGVPLSRWDVAGAALALAGMSVIALQPRG |
| BMA0761 | Burkholderia mallei | 110 | MLSLAKIAALFVLTAVAEIVGCYLPWLVLKAGKPAWLLAPAALSLALFAWLLTLHPAAAARTYAAYGGVYIAVALAWLRIVDGVPLSRWDVAGAALALAGMSVIALQPRG |
The UPF0060 family extends beyond Burkholderia species and includes members in various other gram-negative bacteria. For example, the ZMO1566 protein in Zymomonas mobilis and YnfA proteins in other bacterial species belong to the same protein family . This wide distribution highlights the evolutionary success and functional importance of this protein family across diverse bacterial taxa.
Recombinant Bcep18194_A4425 protein has several potential applications in both basic and applied research:
In structural biology, the purified protein can be utilized for three-dimensional structure determination using techniques such as X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy. Such structural insights would significantly enhance our understanding of the protein's function and mechanism.
For functional characterization, biochemical and biophysical assays can be designed to test the proposed efflux pump activity, particularly for thallium and potentially other heavy metals or antimicrobial compounds. Transport assays using reconstituted protein in liposomes or membrane vesicles could directly demonstrate substrate specificity and transport kinetics.
In the context of antimicrobial research, if the protein indeed functions in drug resistance mechanisms, it could represent a valuable target for developing new antimicrobial strategies against Burkholderia infections. Inhibitors of this protein might potentially resensitize resistant bacteria to existing antibiotics.
For comparative genomics studies, analyzing this protein in relation to homologs from other bacterial species can provide insights into bacterial evolution and adaptation. The conservation patterns across species can reveal functionally critical regions and potential specializations.
Additionally, the recombinant protein could serve as an antigen for generating specific antibodies for detection and localization studies in Burkholderia species, facilitating research on protein expression, regulation, and cellular distribution.
KEGG: bur:Bcep18194_A4425
Recombinant Full Length Burkholderia sp. UPF0060 membrane protein Bcep18194_A4425 (UniProt ID: Q39HP5) is a 110-amino acid protein derived from Burkholderia lata. It is expressed in E. coli with an N-terminal His tag to facilitate purification processes. The protein is generally supplied as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE analysis. This membrane protein belongs to the UPF0060 family, which consists of proteins with currently uncharacterized functions, making it a subject of interest for researchers investigating novel membrane protein functions .
To maintain the structural integrity and functionality of Bcep18194_A4425, the following storage and handling protocols are recommended:
| Storage Parameter | Recommendation |
|---|---|
| Long-term storage | -20°C to -80°C |
| Working aliquots | 4°C for up to one week |
| Buffer composition | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Freeze-thaw cycles | Minimize; repeated cycles not recommended |
| Aliquoting | Essential for multiple use scenarios |
For optimal results, the lyophilized protein should be briefly centrifuged prior to opening to ensure all material is at the bottom of the vial. For reconstitution, sterile deionized water should be used to achieve a concentration of 0.1-1.0 mg/mL. Addition of glycerol to a final concentration of 5-50% is recommended for long-term storage, with 50% being the default recommendation .
Recombinant full-length proteins like Bcep18194_A4425 serve as valuable tools in drug development pipelines. For utilizing this protein in drug discovery:
Target Validation Studies: The protein can be immobilized on sensor chips for surface plasmon resonance (SPR) analysis to screen potential binding partners and inhibitors.
High-Throughput Screening: Develop fluorescence-based or colorimetric assays where Bcep18194_A4425 activity is measured in the presence of compound libraries.
Structure-Based Drug Design: If crystal structures are available, computer-aided drug design can identify potential binding pockets within Bcep18194_A4425.
Binding Affinity Measurements: Isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) can quantify binding parameters between the protein and candidate compounds.
This approach mirrors successful strategies used for other membrane proteins in drug discovery programs. By understanding the binding mechanism of drug candidates to Bcep18194_A4425, researchers can evaluate activity, specificity, and potential off-target effects .
When investigating protein-protein interactions involving Bcep18194_A4425, several complementary approaches can be employed:
| Technique | Application | Advantages | Limitations |
|---|---|---|---|
| Co-immunoprecipitation | Verification of physical interactions | Preserves native conditions | Requires specific antibodies |
| Pull-down assays | Identification of binding partners | Effective with His-tagged Bcep18194_A4425 | May detect non-physiological interactions |
| FRET/BRET | Live-cell interaction dynamics | Real-time monitoring | Requires fluorescent labeling |
| Yeast two-hybrid | Screening for novel interactors | High-throughput | High false-positive rate for membrane proteins |
| Proximity ligation assay | In situ detection | High sensitivity | Complex protocol |
For membrane proteins like Bcep18194_A4425, special considerations include using appropriate detergents for solubilization without disrupting native interactions. Similar methodologies have been successfully employed in studies examining protein-protein interactions in other systems, such as the demonstrated physical interactions between TSHR and CD40 proteins .
The statistical analysis of experimental data involving Bcep18194_A4425 should be carefully designed based on the specific experimental setup:
For binding studies: Nonlinear regression analysis to determine KD values and binding kinetics, with consideration of one-site vs. two-site binding models.
For functional assays: Dose-response curves analyzed using appropriate statistical software to determine EC50/IC50 values.
For comparative studies:
Student's t-test for comparing two experimental conditions
ANOVA for multiple comparisons, followed by post-hoc tests (e.g., Tukey's HSD)
Non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) when normality assumptions are violated
For reproducibility assessment: Calculate coefficient of variation (CV) across technical and biological replicates.
When designing experiments, power analysis should be conducted to determine appropriate sample sizes that minimize both Type I (false positive) and Type II (false negative) errors. Effect size calculations are crucial for interpreting the biological significance of observed differences beyond statistical significance .
The reconstitution of lyophilized Bcep18194_A4425 requires careful attention to maintain protein functionality:
Initial Reconstitution:
Centrifuge vial briefly before opening
Reconstitute in deionized sterile water to 0.1-1.0 mg/mL
Gentle mixing without vortexing to avoid protein denaturation
Buffer Optimization:
For functional studies: Consider including 5-10% glycerol to stabilize the protein
For membrane insertion studies: Gradual dilution into buffers containing appropriate detergents (DDM, CHAPS, or Brij-35)
Proteoliposome Preparation:
Mix purified Bcep18194_A4425 with synthetic lipids in detergent
Remove detergent using Bio-Beads or dialysis
Verify incorporation using sucrose density gradient centrifugation
Activity Verification:
For transport studies: Monitor substrate movement across membranes using fluorescent probes
For binding studies: Confirm proper folding using circular dichroism spectroscopy
The recommended storage buffer (Tris/PBS-based buffer with 6% trehalose at pH 8.0) provides an initial stabilizing environment, but buffer optimization may be required for specific experimental applications .
Investigating post-translational modifications (PTMs) of Bcep18194_A4425 requires specialized techniques:
Mass Spectrometry Approaches:
Liquid chromatography-tandem mass spectrometry (LC-MS/MS) following tryptic digestion
Top-down proteomics for intact protein analysis
Targeted multiple reaction monitoring (MRM) for quantification of specific modifications
Site-Directed Mutagenesis:
Systematic mutation of potential modification sites
Functional comparison between wild-type and mutant proteins
Modification-Specific Antibodies:
Western blotting using antibodies against common PTMs (phosphorylation, glycosylation)
Immunoprecipitation coupled with mass spectrometry
Biochemical Assays:
Phosphatase treatment to confirm phosphorylation
Glycosidase digestion to analyze glycan structures
For bacterial membrane proteins like Bcep18194_A4425, common PTMs include phosphorylation, lipidation, and glycosylation. Each modification potentially influences protein localization, stability, and function, making their characterization essential for comprehensive understanding of protein behavior .
Determining the three-dimensional structure of membrane proteins like Bcep18194_A4425 presents unique challenges requiring specialized techniques:
For Bcep18194_A4425 specifically, its relatively small size (110 amino acids) makes it potentially amenable to solution NMR after isotopic labeling. Detergent micelles, nanodiscs, or lipidic cubic phases can be employed to mimic the membrane environment while maintaining protein stability during structural studies .
To elucidate the physiological function of Bcep18194_A4425:
Gene Knockout/Knockdown Studies:
CRISPR-Cas9 genome editing in Burkholderia lata
RNA interference or antisense approaches
Phenotypic characterization of mutant strains (growth rates, stress responses)
Protein Localization:
Fluorescent protein fusion constructs
Immunogold electron microscopy with specific antibodies
Subcellular fractionation followed by Western blotting
Transcriptomic/Proteomic Profiling:
RNA-Seq comparison between wild-type and knockout strains
Quantitative proteomics to identify affected pathways
Metabolomic analysis to detect changes in cellular metabolism
Interactome Mapping:
Proximity-dependent biotin identification (BioID)
Cross-linking mass spectrometry
Protein microarrays to identify binding partners
Given that Bcep18194_A4425 belongs to the UPF0060 family of uncharacterized membrane proteins, identifying its interacting partners and affected cellular processes upon depletion would provide valuable insights into its biological role .
When investigating drug interactions with Bcep18194_A4425, researchers should address several key considerations:
Binding Site Identification:
Computational docking simulations to predict binding pockets
Site-directed mutagenesis of predicted binding residues
Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions protected upon drug binding
Binding Kinetics Characterization:
Surface plasmon resonance (SPR) for real-time binding analysis
Isothermal titration calorimetry (ITC) for thermodynamic parameters
Fluorescence anisotropy for solution-based binding studies
Functional Impact Assessment:
Transport assays if Bcep18194_A4425 functions as a transporter
Enzyme activity assays if it possesses enzymatic functions
Structural changes using circular dichroism spectroscopy
Specificity Determination:
Counterscreening against related membrane proteins
Off-target binding evaluation using proteome-wide approaches
Selectivity index calculations comparing target vs. off-target effects
Experimental design should include appropriate controls, concentration ranges spanning at least two orders of magnitude around the expected IC50, and multiple technical and biological replicates to ensure statistical robustness .
Despite available information about the sequence and expression of Bcep18194_A4425, significant knowledge gaps remain:
Functional Characterization: The precise biological function of Bcep18194_A4425 remains unknown, as indicated by its classification in the UPF0060 family of uncharacterized proteins.
Structural Information: Detailed three-dimensional structural data is lacking, limiting structure-based functional predictions.
Physiological Relevance: The role of Bcep18194_A4425 in Burkholderia lata physiology, pathogenicity, or environmental adaptation is undefined.
Evolutionary Conservation: Comparative analysis across bacterial species could provide insights into functional importance.
Future research directions might include:
Comprehensive structure determination using cryo-EM or X-ray crystallography
Systematic mutagenesis to identify functionally important residues
Interactome studies to place Bcep18194_A4425 in cellular pathways
Phenotypic characterization of knockout mutants under various environmental conditions
By addressing these knowledge gaps, researchers can better understand this membrane protein's role and potential applications in biotechnology or drug development .