Recombinant Burkholderia sp. UPF0060 membrane protein Bcep18194_A4425 (Bcep18194_A4425)

Shipped with Ice Packs
In Stock

Description

Introduction to Bcep18194_A4425

Bcep18194_A4425 is a membrane protein belonging to the UPF0060 family that has been identified in Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383), formerly classified as Burkholderia cepacia (strain ATCC 17760 / NCIB 9086 / R18194) . The UPF (Uncharacterized Protein Family) designation indicates that the function of this protein family has not been fully elucidated, though recent research suggests potential roles in membrane transport processes.

The recombinant version of Bcep18194_A4425 refers specifically to the protein that has been expressed in a non-native host organism (typically E. coli) with added features such as histidine tags to facilitate purification and study . This recombinant production enables researchers to investigate the protein's properties and functions in controlled laboratory settings.

Burkholderia species comprise a diverse group of gram-negative bacteria found in various environmental niches including soil, water, and plant rhizospheres. Some species are known pathogens, while others have beneficial applications in areas such as bioremediation and biocontrol . Within this genus, the Burkholderia pseudomallei complex (Bpc) has received particular attention due to its inclusion of several clinically significant species . Understanding membrane proteins like Bcep18194_A4425 is essential for deciphering bacterial physiology, environmental adaptations, and potentially pathogenic mechanisms.

Expression and Purification Methodology

The recombinant form of Bcep18194_A4425 protein is predominantly expressed in Escherichia coli expression systems, which provide a reliable and efficient platform for producing bacterial proteins in research quantities . For optimal purification and detection, the protein is typically fused to an N-terminal histidine tag (His-tag), enabling efficient isolation using metal affinity chromatography techniques.

Commercial preparations of this recombinant protein contain the full-length sequence (amino acids 1-110) with the additional His-tag, ensuring that the entire native protein structure is preserved . After expression and purification, the protein generally achieves greater than 90% purity as determined by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) analysis .

The purified recombinant protein is typically provided in lyophilized powder form, suspended in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . This formulation is designed to enhance stability during storage and shipping while maintaining the protein's native conformation and biological activity.

Functional Insights and Classification

While the precise biological function of Bcep18194_A4425 remains to be fully characterized, several lines of evidence provide insights into its potential roles:

According to the KEGG database, Bcep18194_A4425 is associated with K09771 classification, which corresponds to small multidrug resistance family-3 protein . This classification suggests a potential involvement in drug resistance mechanisms, possibly through efflux of antimicrobial compounds or other toxic substances.

Notably, recent comprehensive studies on protein functions across diverse bacteria have proposed that UPF0060-containing proteins may function specifically as thallium-specific efflux pumps . This finding suggests a specialized role in metal ion transport and cellular detoxification processes, which would be particularly relevant given the toxicity of thallium to bacterial cells.

As an integral membrane protein, Bcep18194_A4425 likely participates in crucial cellular processes at the membrane interface. These could include various transport functions, maintenance of membrane integrity, or signal transduction mechanisms that allow the bacterium to respond to environmental changes.

The evolutionary conservation of UPF0060 proteins across multiple bacterial species further indicates they perform important functions in bacterial physiology. This conservation pattern is characteristic of proteins involved in fundamental cellular processes, though specific functions may have diverged between different bacterial lineages during evolution.

Comparison with Related UPF0060 Family Members

Several related UPF0060 membrane proteins have been identified in other Burkholderia species, allowing for comparative analysis that may provide additional functional insights. Notable examples include:

  1. Burkholderia pseudomallei UPF0060 membrane protein BURPS668_1464, a 110-amino acid protein with similar structural features

  2. Burkholderia mallei UPF0060 membrane protein BMA0761, another closely related member of this protein family

Table 2: Comparison of Bcep18194_A4425 with Other Burkholderia UPF0060 Membrane Proteins

ProteinSpeciesLength (aa)Amino Acid Sequence
Bcep18194_A4425Burkholderia lata110MTELMRIAALFAATALAEIVGCYLPWLVLKEGRPVWLLVPAALSLALFAWLLTLHPSAAGRTYAAYGGVYIAVALVWLRVVDGVALTRWDVAGAVLALGGMAVIALQPRA
BURPS668_1464Burkholderia pseudomallei110MLSLAKIAALFVLTAVAEIVGCYLPWLVLKAGKPAWLLAPAALSLALFAWLLTLHPAAAARTYAAYGGVYIAVALAWLRIVDGVPLSRWDVAGAALALAGMSVIALQPRG
BMA0761Burkholderia mallei110MLSLAKIAALFVLTAVAEIVGCYLPWLVLKAGKPAWLLAPAALSLALFAWLLTLHPAAAARTYAAYGGVYIAVALAWLRIVDGVPLSRWDVAGAALALAGMSVIALQPRG

The UPF0060 family extends beyond Burkholderia species and includes members in various other gram-negative bacteria. For example, the ZMO1566 protein in Zymomonas mobilis and YnfA proteins in other bacterial species belong to the same protein family . This wide distribution highlights the evolutionary success and functional importance of this protein family across diverse bacterial taxa.

Research Applications and Potential Significance

Recombinant Bcep18194_A4425 protein has several potential applications in both basic and applied research:

In structural biology, the purified protein can be utilized for three-dimensional structure determination using techniques such as X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy. Such structural insights would significantly enhance our understanding of the protein's function and mechanism.

For functional characterization, biochemical and biophysical assays can be designed to test the proposed efflux pump activity, particularly for thallium and potentially other heavy metals or antimicrobial compounds. Transport assays using reconstituted protein in liposomes or membrane vesicles could directly demonstrate substrate specificity and transport kinetics.

In the context of antimicrobial research, if the protein indeed functions in drug resistance mechanisms, it could represent a valuable target for developing new antimicrobial strategies against Burkholderia infections. Inhibitors of this protein might potentially resensitize resistant bacteria to existing antibiotics.

For comparative genomics studies, analyzing this protein in relation to homologs from other bacterial species can provide insights into bacterial evolution and adaptation. The conservation patterns across species can reveal functionally critical regions and potential specializations.

Additionally, the recombinant protein could serve as an antigen for generating specific antibodies for detection and localization studies in Burkholderia species, facilitating research on protein expression, regulation, and cellular distribution.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its use.
Synonyms
Bcep18194_A4425; UPF0060 membrane protein Bcep18194_A4425
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Target Names
Bcep18194_A4425
Target Protein Sequence
MTELMRIAALFAATALAEIVGCYLPWLVLKEGRPVWLLVPAALSLALFAWLLTLHPSAAG RTYAAYGGVYIAVALVWLRVVDGVALTRWDVAGAVLALGGMAVIALQPRA
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Burkholderia sp. UPF0060 membrane protein Bcep18194_A4425?

Recombinant Full Length Burkholderia sp. UPF0060 membrane protein Bcep18194_A4425 (UniProt ID: Q39HP5) is a 110-amino acid protein derived from Burkholderia lata. It is expressed in E. coli with an N-terminal His tag to facilitate purification processes. The protein is generally supplied as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE analysis. This membrane protein belongs to the UPF0060 family, which consists of proteins with currently uncharacterized functions, making it a subject of interest for researchers investigating novel membrane protein functions .

What are the optimal storage and handling conditions for Bcep18194_A4425?

To maintain the structural integrity and functionality of Bcep18194_A4425, the following storage and handling protocols are recommended:

Storage ParameterRecommendation
Long-term storage-20°C to -80°C
Working aliquots4°C for up to one week
Buffer compositionTris/PBS-based buffer, 6% Trehalose, pH 8.0
Freeze-thaw cyclesMinimize; repeated cycles not recommended
AliquotingEssential for multiple use scenarios

For optimal results, the lyophilized protein should be briefly centrifuged prior to opening to ensure all material is at the bottom of the vial. For reconstitution, sterile deionized water should be used to achieve a concentration of 0.1-1.0 mg/mL. Addition of glycerol to a final concentration of 5-50% is recommended for long-term storage, with 50% being the default recommendation .

How can Bcep18194_A4425 be utilized in drug development studies?

Recombinant full-length proteins like Bcep18194_A4425 serve as valuable tools in drug development pipelines. For utilizing this protein in drug discovery:

  • Target Validation Studies: The protein can be immobilized on sensor chips for surface plasmon resonance (SPR) analysis to screen potential binding partners and inhibitors.

  • High-Throughput Screening: Develop fluorescence-based or colorimetric assays where Bcep18194_A4425 activity is measured in the presence of compound libraries.

  • Structure-Based Drug Design: If crystal structures are available, computer-aided drug design can identify potential binding pockets within Bcep18194_A4425.

  • Binding Affinity Measurements: Isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) can quantify binding parameters between the protein and candidate compounds.

This approach mirrors successful strategies used for other membrane proteins in drug discovery programs. By understanding the binding mechanism of drug candidates to Bcep18194_A4425, researchers can evaluate activity, specificity, and potential off-target effects .

What experimental designs are recommended for studying protein-protein interactions involving Bcep18194_A4425?

When investigating protein-protein interactions involving Bcep18194_A4425, several complementary approaches can be employed:

TechniqueApplicationAdvantagesLimitations
Co-immunoprecipitationVerification of physical interactionsPreserves native conditionsRequires specific antibodies
Pull-down assaysIdentification of binding partnersEffective with His-tagged Bcep18194_A4425May detect non-physiological interactions
FRET/BRETLive-cell interaction dynamicsReal-time monitoringRequires fluorescent labeling
Yeast two-hybridScreening for novel interactorsHigh-throughputHigh false-positive rate for membrane proteins
Proximity ligation assayIn situ detectionHigh sensitivityComplex protocol

For membrane proteins like Bcep18194_A4425, special considerations include using appropriate detergents for solubilization without disrupting native interactions. Similar methodologies have been successfully employed in studies examining protein-protein interactions in other systems, such as the demonstrated physical interactions between TSHR and CD40 proteins .

What statistical approaches are most appropriate for analyzing experimental data with Bcep18194_A4425?

The statistical analysis of experimental data involving Bcep18194_A4425 should be carefully designed based on the specific experimental setup:

  • For binding studies: Nonlinear regression analysis to determine KD values and binding kinetics, with consideration of one-site vs. two-site binding models.

  • For functional assays: Dose-response curves analyzed using appropriate statistical software to determine EC50/IC50 values.

  • For comparative studies:

    • Student's t-test for comparing two experimental conditions

    • ANOVA for multiple comparisons, followed by post-hoc tests (e.g., Tukey's HSD)

    • Non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) when normality assumptions are violated

  • For reproducibility assessment: Calculate coefficient of variation (CV) across technical and biological replicates.

When designing experiments, power analysis should be conducted to determine appropriate sample sizes that minimize both Type I (false positive) and Type II (false negative) errors. Effect size calculations are crucial for interpreting the biological significance of observed differences beyond statistical significance .

What reconstitution protocols optimize Bcep18194_A4425 functionality for in vitro studies?

The reconstitution of lyophilized Bcep18194_A4425 requires careful attention to maintain protein functionality:

  • Initial Reconstitution:

    • Centrifuge vial briefly before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Gentle mixing without vortexing to avoid protein denaturation

  • Buffer Optimization:

    • For functional studies: Consider including 5-10% glycerol to stabilize the protein

    • For membrane insertion studies: Gradual dilution into buffers containing appropriate detergents (DDM, CHAPS, or Brij-35)

  • Proteoliposome Preparation:

    • Mix purified Bcep18194_A4425 with synthetic lipids in detergent

    • Remove detergent using Bio-Beads or dialysis

    • Verify incorporation using sucrose density gradient centrifugation

  • Activity Verification:

    • For transport studies: Monitor substrate movement across membranes using fluorescent probes

    • For binding studies: Confirm proper folding using circular dichroism spectroscopy

The recommended storage buffer (Tris/PBS-based buffer with 6% trehalose at pH 8.0) provides an initial stabilizing environment, but buffer optimization may be required for specific experimental applications .

How can post-translational modifications of Bcep18194_A4425 be studied?

Investigating post-translational modifications (PTMs) of Bcep18194_A4425 requires specialized techniques:

  • Mass Spectrometry Approaches:

    • Liquid chromatography-tandem mass spectrometry (LC-MS/MS) following tryptic digestion

    • Top-down proteomics for intact protein analysis

    • Targeted multiple reaction monitoring (MRM) for quantification of specific modifications

  • Site-Directed Mutagenesis:

    • Systematic mutation of potential modification sites

    • Functional comparison between wild-type and mutant proteins

  • Modification-Specific Antibodies:

    • Western blotting using antibodies against common PTMs (phosphorylation, glycosylation)

    • Immunoprecipitation coupled with mass spectrometry

  • Biochemical Assays:

    • Phosphatase treatment to confirm phosphorylation

    • Glycosidase digestion to analyze glycan structures

For bacterial membrane proteins like Bcep18194_A4425, common PTMs include phosphorylation, lipidation, and glycosylation. Each modification potentially influences protein localization, stability, and function, making their characterization essential for comprehensive understanding of protein behavior .

What are the methodological approaches for determining the three-dimensional structure of Bcep18194_A4425?

Determining the three-dimensional structure of membrane proteins like Bcep18194_A4425 presents unique challenges requiring specialized techniques:

For Bcep18194_A4425 specifically, its relatively small size (110 amino acids) makes it potentially amenable to solution NMR after isotopic labeling. Detergent micelles, nanodiscs, or lipidic cubic phases can be employed to mimic the membrane environment while maintaining protein stability during structural studies .

How can researchers investigate the functional role of Bcep18194_A4425 in bacterial physiology?

To elucidate the physiological function of Bcep18194_A4425:

  • Gene Knockout/Knockdown Studies:

    • CRISPR-Cas9 genome editing in Burkholderia lata

    • RNA interference or antisense approaches

    • Phenotypic characterization of mutant strains (growth rates, stress responses)

  • Protein Localization:

    • Fluorescent protein fusion constructs

    • Immunogold electron microscopy with specific antibodies

    • Subcellular fractionation followed by Western blotting

  • Transcriptomic/Proteomic Profiling:

    • RNA-Seq comparison between wild-type and knockout strains

    • Quantitative proteomics to identify affected pathways

    • Metabolomic analysis to detect changes in cellular metabolism

  • Interactome Mapping:

    • Proximity-dependent biotin identification (BioID)

    • Cross-linking mass spectrometry

    • Protein microarrays to identify binding partners

Given that Bcep18194_A4425 belongs to the UPF0060 family of uncharacterized membrane proteins, identifying its interacting partners and affected cellular processes upon depletion would provide valuable insights into its biological role .

What considerations should be made when designing experiments to study potential drug interactions with Bcep18194_A4425?

When investigating drug interactions with Bcep18194_A4425, researchers should address several key considerations:

  • Binding Site Identification:

    • Computational docking simulations to predict binding pockets

    • Site-directed mutagenesis of predicted binding residues

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions protected upon drug binding

  • Binding Kinetics Characterization:

    • Surface plasmon resonance (SPR) for real-time binding analysis

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Fluorescence anisotropy for solution-based binding studies

  • Functional Impact Assessment:

    • Transport assays if Bcep18194_A4425 functions as a transporter

    • Enzyme activity assays if it possesses enzymatic functions

    • Structural changes using circular dichroism spectroscopy

  • Specificity Determination:

    • Counterscreening against related membrane proteins

    • Off-target binding evaluation using proteome-wide approaches

    • Selectivity index calculations comparing target vs. off-target effects

Experimental design should include appropriate controls, concentration ranges spanning at least two orders of magnitude around the expected IC50, and multiple technical and biological replicates to ensure statistical robustness .

What are the current knowledge gaps regarding Bcep18194_A4425 and how might future research address them?

Despite available information about the sequence and expression of Bcep18194_A4425, significant knowledge gaps remain:

  • Functional Characterization: The precise biological function of Bcep18194_A4425 remains unknown, as indicated by its classification in the UPF0060 family of uncharacterized proteins.

  • Structural Information: Detailed three-dimensional structural data is lacking, limiting structure-based functional predictions.

  • Physiological Relevance: The role of Bcep18194_A4425 in Burkholderia lata physiology, pathogenicity, or environmental adaptation is undefined.

  • Evolutionary Conservation: Comparative analysis across bacterial species could provide insights into functional importance.

Future research directions might include:

  • Comprehensive structure determination using cryo-EM or X-ray crystallography

  • Systematic mutagenesis to identify functionally important residues

  • Interactome studies to place Bcep18194_A4425 in cellular pathways

  • Phenotypic characterization of knockout mutants under various environmental conditions

By addressing these knowledge gaps, researchers can better understand this membrane protein's role and potential applications in biotechnology or drug development .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.