Recombinant Burkholderia thailandensis Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Description

Biological Functions in Burkholderia thailandensis

DsbB is essential for the maturation of secreted proteins, including virulence factors and enzymes. Its roles include:

  • Protease and phosphatase activation: Defects in DsbB impair extracellular protease and alkaline phosphatase production, critical for bacterial invasion .

  • Motility regulation: DsbB mutants exhibit reduced flagellar motility due to misfolded flagellar proteins (e.g., FlgI) .

  • Antibiotic resistance: Disruption of DsbB increases sensitivity to β-lactams, aminoglycosides, and detergents (e.g., SDS), suggesting its role in multidrug resistance .

Table 2: Functional Impacts of DsbB Deficiency

PhenotypeObserved EffectMechanismSource
Protease productionReduced activityMisfolded metalloproteases (e.g., ZmpA)
MotilityImpaired flagellar assemblyDefective FlgI/P-ring proteins
Antibiotic resistanceIncreased sensitivityCompromised efflux pump function

Research Applications

Recombinant DsbB is utilized in:

  • ELISA assays: For detecting DsbB-specific antibodies in immune studies .

  • Vaccine development: As a candidate antigen due to its conservation across Burkholderia species .

  • Protein folding studies: To investigate disulfide bond systems in pathogenic bacteria .

Comparative Analysis with Other Systems

DsbB homologs are conserved across Burkholderia species but exhibit functional divergence compared to other bacteria:

FeatureB. thailandensis DsbBE. coli DsbB
Primary partnerDsbA (periplasmic)DsbA (periplasmic)
Motility dependenceCritical for flagellar functionPartially redundant with DsbLI
Virulence substrate scope~73 core proteins (predicted)~90 substrates (validated)

Key Research Findings

  1. Metal Efflux System Link: DsbB mutants show increased Cd²⁺/Zn²⁺ sensitivity, implying a role in metal ion detoxification .

  2. Swarming Motility: DsbB contributes to rhamnolipid-dependent surface motility, though redundant systems may compensate .

  3. Cross-Species Consistency: B. pseudomallei and B. cepacia DsbB orthologs share >50% identity, enabling pan-Burkholderia targeting strategies .

Challenges and Future Directions

  • Structural Elucidation: High-resolution crystallography of DsbB to map redox-active site interactions.

  • Therapeutic Targeting: Inhibiting DsbB to disrupt virulence without compromising host disulfide systems.

  • Biotechnological Use: Engineering DsbB for in vitro protein refolding applications.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will then prepare the product according to your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize the development of the specified tag.
Synonyms
dsbB; BTH_I1614; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264)
Target Names
dsbB
Target Protein Sequence
MNNLTLSLHRERRLLVLLGLVCLALLAGALYLQYVKNEDPCPLCIIQRYFFVLIAVFAFI GAGMASGAGIAVIEALIVLSAAAGVGTAARHLYVQLNPGFSCGFDALQPVVDSLPPAHWL PGVFKVAGLCETVYPPIFGILLPGWALIAFALIVVPVAASLLRHRGRLR
Uniprot No.

Target Background

Function
This protein is essential for disulfide bond formation in certain periplasmic proteins. It functions by oxidizing the DsbA protein.
Database Links
Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Burkholderia thailandensis and why is it used as a model for studying bacterial proteins?

Burkholderia thailandensis is a soil-dwelling bacillus closely related to the highly pathogenic B. pseudomallei (causative agent of melioidosis) and B. mallei (causative agent of glanders). Despite this close relationship, B. thailandensis is considered mildly pathogenic to immunocompetent humans, making it an excellent model organism for studying Burkholderia biology. B. thailandensis expresses homologs of many known virulence factors found in more pathogenic Burkholderia species and employs similar molecular strategies for host cell infection and replication .

A significant advantage of using B. thailandensis as a research model is its biosafety classification. Unlike B. pseudomallei which requires biosafety level 3 (BSL-3) containment facilities, B. thailandensis can be studied in BSL-2 laboratories and is exempt from Select Agent regulations that limit distribution and genetic manipulation of more virulent Burkholderia species . This accessibility makes B. thailandensis invaluable for studying proteins like dsbB that may have conserved functions across Burkholderia species.

What genetic diversity exists among B. thailandensis strains that might affect recombinant protein studies?

Recent environmental surveillance studies have revealed substantial genetic diversity among B. thailandensis strains. In a 2019 study conducted in Sierra Leone, researchers identified seven novel B. thailandensis sequence types using multi-locus sequence typing (MLST) and 16S rRNA gene sequence analyses . Phylogenetic analysis based on concatenated sequences of seven household genes revealed two main clusters of B. thailandensis strains: Cluster I containing isolates exclusively from Asia and Oceania, and Cluster II comprising isolates from Sierra Leone and Gabon .

This genetic diversity has important implications for recombinant protein studies, as different B. thailandensis strains may exhibit variations in protein expression systems, post-translational modifications, and regulatory networks. Researchers working with recombinant dsbB should carefully document and consider the specific strain being used, as strain variation could impact protein structure, function, and expression levels.

What expression systems are most suitable for recombinant dsbB production in B. thailandensis?

For optimal expression of recombinant proteins in B. thailandensis, the ribosomal protein S12 gene promoter (Ps12) has proven effective for driving constitutive expression . When expressing potentially toxic membrane proteins like dsbB, a regulated expression system may be preferable. The Mini-Tn7 transposon system developed for Burkholderia species provides an excellent platform for integration of recombinant genes into the B. thailandensis genome .

To implement this system for recombinant dsbB expression, researchers can:

  • Clone the dsbB gene into a Mini-Tn7 vector downstream of an appropriate promoter

  • Utilize the Tn7 transposon attachment sites downstream of glucosamine-6-phosphate synthetase genes (glmS1/2) for site-specific directional transposition

  • Select transformed bacteria using appropriate antibiotic resistance markers, such as kanamycin

This approach ensures stable integration of the dsbB gene into the B. thailandensis genome, allowing for consistent expression levels compared to plasmid-based systems that may exhibit copy number variations.

How can genetic modifications be introduced to study dsbB function in B. thailandensis?

The genetic tractability of B. thailandensis makes it amenable to various genetic manipulation strategies for studying protein function. For dsbB studies, researchers can employ:

  • Gene deletion or disruption using allelic exchange vectors

  • Site-directed mutagenesis to study specific functional domains

  • Epitope tagging for protein detection and purification

  • Promoter fusions to study gene expression patterns

When introducing genetic modifications, researchers should be aware that B. thailandensis E264 populations can be genotypically heterogeneous . PCR analysis of individual colonies is recommended to confirm genetic modifications and ensure population homogeneity.

A particularly relevant finding for genetic studies is that B. thailandensis undergoes RecA-mediated homologous recombination between insertion sequence (IS) elements, which can duplicate large DNA regions (up to 208.6 kb containing 157 coding sequences) . This natural recombination system should be considered when designing genetic manipulation strategies, as it may interfere with intended genetic modifications or create unexpected genomic rearrangements.

How can bio-orthogonal noncanonical amino acid tagging (BONCAT) be applied to study dsbB dynamics during infection?

BONCAT represents a powerful approach for studying bacterial protein expression during host infection. This technique has been successfully applied to B. thailandensis by expressing the E. coli methionyl-tRNA synthetase MetRS NLL gene, optimized for expression in Burkholderia species . The modified MetRS NLL allows for the incorporation of the non-canonical amino acid azidonorleucine (Anl) into newly synthesized bacterial proteins.

For dsbB-specific applications, researchers can:

  • Generate a B. thailandensis strain expressing both MetRS NLL and recombinant dsbB

  • Infect host cells with this strain in the presence of Anl

  • Selectively label newly synthesized bacterial proteins, including dsbB

  • Enrich labeled proteins using click chemistry

  • Analyze dsbB expression, modification, and interactions during different stages of infection

This approach overcomes the challenge of studying bacterial proteins against the overwhelming background of host proteins during infection . BONCAT provides temporal resolution of protein synthesis, allowing researchers to track dsbB expression dynamics throughout the infection process.

What approaches can be used to study dsbB protein-protein interactions in B. thailandensis?

Understanding dsbB interactions with substrate proteins is crucial for elucidating its function in disulfide bond formation. Several complementary approaches can be employed:

  • Bacterial two-hybrid systems adapted for membrane proteins

  • Co-immunoprecipitation followed by mass spectrometry

  • Chemical crosslinking to capture transient interactions

  • FRET-based assays for monitoring interactions in live cells

  • Proximity labeling techniques such as BioID or APEX2

When studying membrane proteins like dsbB, special consideration should be given to maintaining the native membrane environment or using appropriate detergents during purification to preserve protein-protein interactions. Comparative proteomics between wild-type and dsbB mutant strains can also reveal potential substrate proteins that depend on dsbB for proper folding.

What are the major challenges in purifying functional recombinant dsbB from B. thailandensis?

Purification of membrane proteins like dsbB presents several technical challenges:

  • Low natural expression levels requiring optimization of overexpression systems

  • Difficulty in extraction from the membrane while maintaining protein structure

  • Limited solubility in aqueous solutions necessitating detergent use

  • Potential toxicity when overexpressed

  • Maintaining the redox state of catalytic cysteine residues

To address these challenges, researchers can:

  • Use mild detergents like n-dodecyl-β-D-maltoside (DDM) for membrane solubilization

  • Employ affinity tags (His, Strep, FLAG) positioned to minimize interference with function

  • Optimize purification conditions including buffer pH, salt concentration, and reducing agents

  • Consider nanodiscs or amphipols for maintaining protein in a native-like membrane environment

  • Include appropriate redox buffers to maintain the correct oxidation state of catalytic cysteines

How can researchers assess the functional activity of recombinant dsbB in vitro?

Functional characterization of purified dsbB is essential for structure-function studies. Activity assays for dsbB typically measure its ability to oxidize dsbA, its physiological electron acceptor. Several approaches can be employed:

  • Ubiquinone reduction assays monitoring spectrophotometric changes

  • Fluorescent peptide substrate assays measuring disulfide bond formation rates

  • Coupled enzyme assays with purified dsbA and model substrates

  • Redox state analysis using alkylating agents and gel shift assays

When adapting these assays for B. thailandensis dsbB, researchers should consider potential differences in redox potentials, substrate specificity, and optimal reaction conditions compared to well-characterized dsbB proteins from model organisms like E. coli.

How does dsbB contribute to B. thailandensis pathogenicity in different infection models?

While B. thailandensis is considered less pathogenic to humans than B. pseudomallei, it exhibits virulence in various in vitro and animal infection models . The contribution of dsbB to this virulence can be assessed using:

  • Cell culture infection models measuring bacterial invasion and intracellular replication

  • Animal infection models evaluating virulence and tissue colonization

  • Comparative proteomics identifying virulence factors affected by dsbB mutation

  • Transcriptional profiling during infection to monitor dsbB expression

Previous studies have shown that B. thailandensis shares many virulence mechanisms with more pathogenic Burkholderia species, including the ability to survive and replicate in mammalian cells, escape from endocytic vacuoles, and spread from cell to cell . Disulfide bond formation is likely critical for the proper folding and function of virulence factors involved in these processes.

How can the Bsa Type III Secretion System (TTSS) function be linked to dsbB activity?

The Bsa Type III Secretion System (TTSS) is a crucial virulence determinant in Burkholderia species, and B. thailandensis possesses a functional Bsa TTSS similar to that found in B. pseudomallei . Given that many secreted virulence factors and components of secretion machinery require proper disulfide bond formation for stability and function, dsbB likely plays an important role in TTSS functionality.

Researchers can investigate this relationship by:

  • Generating dsbB mutants and assessing TTSS assembly and function

  • Monitoring secretion of TTSS effectors in wild-type versus dsbB-deficient strains

  • Examining the redox state of TTSS components in various genetic backgrounds

  • Performing complementation studies with dsbB from different Burkholderia species

The BSL-2 status of B. thailandensis makes it an ideal model system for these studies, with findings potentially applicable to understanding virulence mechanisms in more dangerous Burkholderia species .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.