Recombinant Burkholderia thailandensis Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Burkholderia thailandensis Glycerol-3-phosphate Acyltransferase (plsY)

Recombinant Burkholderia thailandensis glycerol-3-phosphate acyltransferase (plsY) is a bacterial enzyme critical for lipid biosynthesis. It catalyzes the transfer of acyl groups from acyl-coenzyme A (acyl-CoA) to glycerol-3-phosphate (G3P), forming lysophosphatidic acid (LPA), a precursor for phospholipid synthesis . This enzyme is homologous to eukaryotic glycerol-3-phosphate acyltransferases (GPATs) and plays a conserved role in membrane lipid metabolism.

The recombinant version of B. thailandensis plsY is engineered with an N-terminal His-tag for efficient purification via nickel-affinity chromatography. It is expressed in Escherichia coli and retains full catalytic activity, making it valuable for biochemical studies, biotechnological applications, and structural analysis .

Expression and Purification

The recombinant plsY is produced under optimized conditions in E. coli:

  • Expression: Induced by IPTG or rhamnose, depending on vector design.

  • Purification:

    1. Lysis: Sonication or enzymatic methods to disrupt E. coli cells.

    2. Ni-NTA Affinity Chromatography: His-tag binds nickel, enabling elution with imidazole.

    3. Final Step: Dialysis to remove impurities and imidazole .

Purified plsY retains enzymatic activity, as confirmed by in vitro assays measuring LPA production from G3P and acyl-CoA substrates.

Role in Lipid Metabolism

plsY is essential for initiating B. thailandensis phospholipid biosynthesis. In Burkholderia spp., lipid metabolism is tightly regulated, with interplay between enzymes like plsY and other acyltransferases (e.g., oacA, which modifies lipopolysaccharides) . While oacA governs O-acetylation of lipopolysaccharides, plsY focuses on membrane phospholipid assembly.

Applications in Research

  1. Biochemical Studies:

    • Characterization of substrate specificity (e.g., preference for saturated vs. unsaturated acyl-CoA).

    • Kinetic analysis (e.g., K<sub>m</sub>, V<sub>max</sub>) using purified enzyme.

  2. Structural Biology:

    • Crystallization studies to resolve active-site architecture.

    • Mutagenesis of conserved residues (e.g., Ser-Thr-Gly triad) to probe catalytic mechanisms.

Lipid-Modifying Enzymes

EnzymeFunctionRelevance to plsY
oacA4-O-acetylation of LPS O-antigenModifies lipid A core structure
AhpCPeroxidase for oxidative stress resistanceMaintains redox balance during lipid synthesis
ScmRGlobal regulator of secondary metabolismMay indirectly regulate plsY expression

Challenges and Future Directions

  1. Substrate Specificity: Limited data exist on plsY’s preference for acyl-CoA chain lengths (e.g., C14:0 vs. C18:1).

  2. Regulation: Potential cross-talk with quorum sensing (QS) systems (e.g., BtaR1/BtaI1) in lipid homeostasis .

  3. Pathogenic Implications: B. thailandensis is a model for B. pseudomallei and B. mallei; plsY inhibition could disrupt pathogen membrane integrity.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. To request a specific tag, please indicate this in your order; we will prioritize its development.
Synonyms
plsY; BTH_I0729; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264)
Target Names
plsY
Target Protein Sequence
MQILLATVAAYLIGSVSFAVVVSAAMGLADPRSYGSKNPGATNVLRGGNKKAAILTLVGD AFKGWLAVWLVKHFGIGGEIGVALAAIAVFLGHLYPVFFRFQGGKGVATAAGVLLAVHPA LGLATALTWLIIAFFFRYSSLAALVAAVFAPVFDVFLFGTRNNPVAWAVIAMSALLIWRH RSNISKLLAGEESRIGQKKTDA
Uniprot No.

Target Background

Function

This recombinant Burkholderia thailandensis Glycerol-3-phosphate acyltransferase (PlsY) catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO4) to glycerol-3-phosphate (G3P), producing lysophosphatidic acid (LPA). The enzyme utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.

Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Glycerol-3-phosphate acyltransferase (plsY) and what is its role in Burkholderia thailandensis?

Glycerol-3-phosphate acyltransferase (plsY) is a critical enzyme that catalyzes the first step in the biosynthesis of membrane phospholipids by transferring an acyl group from acyl-CoA to glycerol-3-phosphate, producing lysophosphatidic acid. In Burkholderia thailandensis, plsY plays an essential role in phospholipid synthesis necessary for cell membrane formation. Unlike mammalian systems that have multiple GPAT isoforms (GPAT1-4) classified based on subcellular localization, substrate preferences, and N-ethylmaleimide (NEM) sensitivity, bacterial plsY represents a more streamlined system for studying acyltransferase function . This enzyme is fundamental to bacterial survival as it contributes to membrane biogenesis, which is essential for growth, replication, and cell division in B. thailandensis.

How does B. thailandensis plsY differ from GPAT enzymes in other organisms?

B. thailandensis plsY belongs to a bacterial acyltransferase family that is structurally and mechanistically distinct from the eukaryotic GPAT enzymes. While mammalian systems have evolved four GPAT isoforms (GPAT1 and GPAT2 localized to the mitochondrial outer membrane, and GPAT3 and GPAT4 in the endoplasmic reticulum membrane), B. thailandensis uses the more simplified plsY system . The bacterial plsY shows different substrate specificities and kinetic properties compared to mammalian counterparts. Additionally, bacterial plsY is not involved in triglyceride synthesis pathways that are prominent in mammalian systems, where GPATs have been implicated in metabolic disorders including obesity, hepatic steatosis, and insulin resistance .

What expression systems are most suitable for producing recombinant B. thailandensis plsY?

The optimal expression system for recombinant B. thailandensis plsY depends on research objectives and downstream applications. E. coli is often the first-choice host due to its rapid growth, high protein yields, and established genetic tools. For recombinant expression in E. coli, key considerations include:

  • Vector selection: pET-based vectors with T7 promoters offer high expression levels for plsY.

  • Expression conditions: IPTG concentration (typically 0.1-1.0 mM), temperature (often reduced to 16-25°C to enhance solubility), and duration (4-24 hours).

  • Solubility enhancement: Fusion tags such as MBP, SUMO, or thioredoxin can improve solubility.

For more native-like expression, heterologous expression within Burkholderia species may be advantageous. When using B. thailandensis itself as an expression host, the rhamnose-inducible promoter system (pSCrhaB2) has proven effective for controlled gene expression, as evidenced by its successful application with other B. thailandensis proteins .

How do quorum sensing systems in B. thailandensis influence plsY expression and function?

B. thailandensis possesses three complete quorum sensing (QS) circuits (QS-1, QS-2, and QS-3), which regulate various cellular processes in response to population density . Current research suggests complex interactions between quorum sensing and membrane lipid metabolism in Burkholderia species. The potential regulatory relationship between QS systems and plsY expression represents an important area for investigation.

BtaR1, BtaR2, and BtaR3 are key transcriptional regulators in the B. thailandensis QS systems that respond to specific acyl-homoserine lactone signals: C8-HSL (QS-1), 3OHC10-HSL (QS-2), and 3OHC8-HSL (QS-3) . Experimental approaches to investigate QS effects on plsY include:

  • Gene expression analysis in QS mutant strains (ΔbtaI1, ΔbtaI2, ΔbtaI3)

  • Chromatin immunoprecipitation (ChIP) assays to detect QS regulator binding to plsY promoter regions

  • Reporter gene assays using plsY promoter-luciferase fusions to quantify expression changes in response to synthetic acyl-HSLs

The rhamnose-inducible expression system (pSCrhaB2) provides a valuable tool for controlled expression studies in B. thailandensis, offering advantages over arabinose-inducible systems since B. thailandensis is known to metabolize arabinose .

What methods are most effective for assessing the enzymatic activity of recombinant B. thailandensis plsY?

Multiple complementary approaches are recommended for comprehensive assessment of recombinant plsY activity:

Table 1: Enzymatic Assay Methods for plsY Activity Assessment

MethodPrincipleAdvantagesLimitations
Radiometric assayMeasures incorporation of 14C-labeled acyl-CoA into lysophosphatidic acidHigh sensitivity; direct quantificationRequires radioisotope handling; specialized equipment
Coupled spectrophotometric assayMeasures CoA release via thiol detection reagents (DTNB)Real-time kinetics; no radioisotopesIndirect measurement; potential interference
HPLC/MS-based assayDirect detection of lysophosphatidic acid productHigh specificity; identifies product structureRequires specialized equipment; lower throughput
Fluorescence-based assayUses fluorescent acyl-CoA analogsHigh sensitivity; potential for high-throughputSubstrate analog may alter enzyme kinetics

For kinetic characterization, the radiometric assay provides the most reliable data for determining Km and Vmax values for both glycerol-3-phosphate and various acyl-CoA substrates. Critical considerations include:

  • Buffer optimization (pH 7.0-7.5, 10-20 mM Mg2+)

  • Substrate concentration ranges (50-500 μM for acyl-CoA substrates)

  • Detergent selection for enzyme stabilization (0.1-0.5% Triton X-100)

  • Temperature control (30-37°C optimal for B. thailandensis enzymes)

What structural and functional insights can be gained from site-directed mutagenesis of B. thailandensis plsY?

Site-directed mutagenesis represents a powerful approach for elucidating the structure-function relationships of B. thailandensis plsY. Based on homology modeling and alignment with characterized bacterial plsY enzymes, several residue categories warrant investigation:

  • Catalytic residues: Conserved histidine residues in the HX4D motif are predicted to coordinate Mg2+ and participate in catalysis

  • Substrate binding residues: Positively charged residues (Arg, Lys) likely interact with the phosphate group of glycerol-3-phosphate

  • Acyl chain binding pocket: Hydrophobic residues forming the binding pocket determine acyl-CoA chain length specificity

For optimal experimental design, consider:

  • Creating an alanine-scanning library targeting conserved residues

  • Using the rhamnose-inducible expression system for complementation studies in B. thailandensis plsY knockouts

  • Employing both in vitro enzyme assays and in vivo growth/membrane composition analysis to assess mutant effects

How should I design experiments to express and purify recombinant B. thailandensis plsY?

Designing robust experiments for expressing and purifying recombinant B. thailandensis plsY requires careful consideration of multiple variables. A systematic approach should include:

Expression System Selection:

  • Define clearly the experimental variables (expression vector, host strain, induction conditions, temperature, media composition)

  • For initial screening, test multiple expression systems in parallel:

    • E. coli BL21(DE3) with pET vectors (T7 promoter)

    • E. coli C41/C43 strains (membrane protein specialists)

    • Rhamnose-inducible Burkholderia expression system (pSCrhaB2)

Purification Strategy:

  • Design a two-step purification scheme:

    • Affinity chromatography (His-tag or alternative tag)

    • Size exclusion or ion exchange chromatography

  • Include appropriate controls:

    • Empty vector control

    • Known active enzyme control

    • Detergent optimization panel (LDAO, DDM, Triton X-100)

Critical Considerations:

  • Membrane association: plsY is a membrane-associated enzyme requiring detergent for solubilization

  • Protein stability: Include stabilizing agents (glycerol 10-20%, reducing agents)

  • Activity verification: Incorporate activity assays at multiple purification stages

For optimal results, factorial experimental design should be employed to systematically vary expression conditions (temperature, inducer concentration, time) while monitoring both yield and activity .

What are the key considerations for designing knockout and complementation studies for B. thailandensis plsY?

Designing effective knockout and complementation studies for B. thailandensis plsY requires careful genetic strategy development:

Knockout Strategy:

  • Allelic replacement approaches using suicide vectors like pJRC115 are preferred for B. thailandensis genetic manipulation

  • Design homology arms (800-1000 bp) flanking the plsY gene

  • Include selectable markers (antibiotic resistance) and counter-selection markers (sacB)

  • Verify knockout by:

    • PCR confirmation of gene deletion

    • RT-PCR confirmation of transcript absence

    • Western blot confirmation of protein absence

Complementation Strategy:

  • Use the rhamnose-inducible pSCrhaB2 vector system, which has proven effective in B. thailandensis

  • Create complementation constructs with:

    • Native plsY coding sequence

    • C-terminal or N-terminal epitope tags (if activity permits)

    • Site-directed mutants for structure-function analysis

  • Verify complementation by:

    • RT-PCR or Western blot

    • Functional rescue of growth phenotypes

    • Restoration of membrane phospholipid composition

Experimental Controls:

  • Use wild-type B. thailandensis as positive control

  • Include empty vector complementation as negative control

  • Consider partial complementation with homologs from related species

Since plsY likely plays an essential role in membrane biosynthesis, conditional knockout approaches may be necessary, such as using an inducible promoter to control expression of a second copy before deleting the native gene.

How should I analyze and interpret kinetic data from B. thailandensis plsY enzymatic assays?

Rigorous analysis of enzymatic kinetic data from B. thailandensis plsY requires careful consideration of assay conditions and appropriate mathematical models:

Data Collection Protocol:

  • Measure initial reaction velocities across a range of substrate concentrations (5-7 concentrations spanning 0.2-5× Km)

  • Ensure linearity of assay response over measurement period

  • Include technical replicates (n=3) and biological replicates (n=3) for statistical validity

Kinetic Model Selection:

  • For single substrate analysis (fixed concentration of second substrate), use the Michaelis-Menten equation:
    v=Vmax×[S]Km+[S]v = \frac{V_{max} \times [S]}{K_m + [S]}

  • For bi-substrate analysis, consider:

    • Ping-pong mechanism:
      v=Vmax×[A]×[B]KmA×[B]+KmB×[A]+[A]×[B]v = \frac{V_{max} \times [A] \times [B]}{K_m^A \times [B] + K_m^B \times [A] + [A] \times [B]}

    • Sequential mechanism:
      v=Vmax×[A]×[B]Kia×KmB+KmB×[A]+KmA×[B]+[A]×[B]v = \frac{V_{max} \times [A] \times [B]}{K_{ia} \times K_m^B + K_m^B \times [A] + K_m^A \times [B] + [A] \times [B]}

Data Interpretation Framework:

  • Compare Km values for different acyl-CoA substrates to determine chain-length preference

  • Analyze Vmax/Km ratios as measures of catalytic efficiency

  • Examine pH and temperature profiles for optimal conditions

  • For inhibitor studies, determine Ki values and inhibition mechanisms

Use non-linear regression analysis rather than linear transformations (Lineweaver-Burk) for more accurate parameter estimation. Software packages like GraphPad Prism or R with enzyme kinetics packages provide robust analysis tools.

What approaches should I use to analyze the impact of plsY modifications on B. thailandensis membrane composition?

Comprehensive analysis of membrane composition changes resulting from plsY modifications requires a multi-faceted analytical approach:

Lipid Extraction and Analysis Protocol:

  • Extract total lipids using Bligh-Dyer or modified Folch methods

  • Separate lipid classes by thin-layer chromatography (TLC) or solid-phase extraction

  • Analyze phospholipid molecular species by liquid chromatography-mass spectrometry (LC-MS/MS)

  • Quantify fatty acid profiles by gas chromatography-mass spectrometry (GC-MS) after derivatization

Data Analysis Strategy:

  • Conduct targeted analysis of key membrane phospholipids:

    • Phosphatidylethanolamine (PE)

    • Phosphatidylglycerol (PG)

    • Cardiolipin (CL)

  • Perform untargeted lipidomics to identify unexpected lipid changes

  • Compare acyl chain profiles (length, saturation) between wild-type and modified strains

Statistical Approaches:

  • Use multivariate statistical methods:

    • Principal Component Analysis (PCA) to visualize global lipid profile changes

    • Partial Least Squares Discriminant Analysis (PLS-DA) for classification

  • Apply appropriate univariate tests with correction for multiple comparisons:

    • ANOVA with Tukey's post-hoc for multiple group comparisons

    • t-tests with Bonferroni correction for pairwise comparisons

Interpretation Framework:

  • Correlate changes in membrane phospholipid composition with:

    • Growth phenotypes

    • Membrane fluidity (measured by fluorescence anisotropy)

    • Antibiotic susceptibility profiles

    • Stress response characteristics

What techniques are available for studying protein-protein interactions involving B. thailandensis plsY?

Multiple complementary techniques can be employed to investigate protein-protein interactions involving B. thailandensis plsY:

In vivo Approaches:

  • Bacterial two-hybrid systems:

    • Adenylate cyclase-based (BACTH) system

    • Modified yeast two-hybrid adapted for bacterial membrane proteins

  • Protein fragment complementation assays:

    • Split GFP complementation

    • Split luciferase assays

In vitro Approaches:

  • Co-immunoprecipitation (Co-IP) using epitope-tagged plsY

  • Pull-down assays with purified recombinant plsY

  • Surface plasmon resonance (SPR) or biolayer interferometry (BLI) for quantitative binding kinetics

  • Microscale thermophoresis (MST) for interaction studies in detergent solutions

Structural Approaches:

  • Cross-linking mass spectrometry (XL-MS) to identify interaction sites

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map binding interfaces

  • Cryo-electron microscopy for structural characterization of protein complexes

When designing protein interaction studies for plsY, consider:

  • The membrane-associated nature of plsY requires appropriate detergents or membrane mimetics

  • Controls must include known non-interacting proteins

  • Quantification should include affinity measurements (Kd values) when possible

  • Validation should employ multiple independent techniques

How can I integrate omics approaches to comprehensively study the role of plsY in B. thailandensis?

A multi-omics approach provides the most comprehensive understanding of plsY function in B. thailandensis:

Integrated Omics Strategy:

  • Genomics:

    • Comparative genomic analysis of plsY across Burkholderia species

    • Identification of genomic context and potential operonic structures

  • Transcriptomics:

    • RNA-Seq analysis comparing wild-type and plsY mutants

    • Identification of co-regulated genes through correlation network analysis

    • Examination of transcriptional responses to different growth conditions

  • Proteomics:

    • Global proteome analysis using LC-MS/MS

    • Protein-protein interaction studies using immunoprecipitation-mass spectrometry (IP-MS)

    • Phosphoproteomics to identify regulatory modifications

  • Lipidomics:

    • Comprehensive phospholipid profiling by LC-MS/MS

    • Acyl chain composition analysis by GC-MS

    • Membrane microdomain characterization

  • Metabolomics:

    • Targeted analysis of glycerolipid pathway intermediates

    • Global metabolic profiling to identify unexpected metabolic impacts

Data Integration Framework:

  • Use pathway enrichment analysis to identify affected biological processes

  • Apply network analysis to identify functional modules

  • Develop predictive models of plsY function in cellular metabolism

  • Validate key predictions through targeted experiments

Table 2: Multi-omics Data Integration for plsY Function Analysis

Omics LayerKey TechnologiesPrimary InsightsIntegration Approach
GenomicsWhole genome sequencingGene conservation, syntenyPhylogenetic context
TranscriptomicsRNA-SeqGene regulation networksCo-expression modules
ProteomicsLC-MS/MS, IP-MSProtein interactions, abundanceProtein-protein networks
LipidomicsLC-MS/MS, GC-MSMembrane composition changesLipid pathway mapping
MetabolomicsLC-MS, GC-MSMetabolic consequencesFlux analysis

Successful multi-omics integration requires standardized experimental conditions, appropriate normalization methods, and sophisticated computational approaches for data integration and visualization.

What are the best practices for studying the role of plsY in B. thailandensis pathogenicity and host interaction models?

Although B. thailandensis is generally considered non-pathogenic, it can cause infections at sufficiently high doses and serves as a model for studying the more virulent B. pseudomallei and B. mallei . When investigating plsY's role in host interactions:

Infection Model Selection:

  • Cell culture models:

    • Macrophage cell lines (J774, RAW264.7) for phagocyte interactions

    • Epithelial cell lines for adhesion/invasion studies

    • Primary cell cultures for more physiologically relevant responses

  • Alternative host models:

    • Caenorhabditis elegans for high-throughput screening

    • Galleria mellonella for innate immune responses

    • Dictyostelium discoideum for phagocytosis studies

  • Mammalian models (requiring appropriate justification and ethical approval):

    • Mouse models for systemic infection studies

    • Specialized models for specific disease manifestations

Experimental Approaches:

  • Compare wild-type, plsY-depleted, and complemented strains for:

    • Intracellular survival in macrophages

    • Adherence and invasion of epithelial cells

    • Biofilm formation on biological surfaces

    • Resistance to host defense mechanisms

  • Measure host responses:

    • Cytokine/chemokine production

    • Inflammasome activation

    • Reactive oxygen/nitrogen species production

    • Autophagy and xenophagy responses

Data Analysis and Interpretation:

  • Use time-course experiments to distinguish between different stages of host interaction

  • Apply appropriate statistical methods for different experimental designs:

    • Survival analysis for infection outcome studies

    • ANOVA for multiple group comparisons

    • Mixed effects models for repeated measures designs

  • Correlate phenotypes with specific lipid composition changes to develop mechanistic hypotheses about plsY's role in host interactions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.