Recombinant Burkholderia thailandensis Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Functional Role

MscL acts as an osmotic emergency release valve, discharging cytoplasmic osmolytes during rapid osmotic shifts to prevent cell lysis. Its conductance reaches ~3 nS in the open state .

Mechanosensitive Gating Mechanisms

  • Key Residues:

    • N103 (TM2): Critical for gating; cysteine mutations or sulfhydryl modifications (e.g., MTSSL) disrupt lipid-protein interactions, stabilizing subconducting states .

    • L89 (TM2): Bulky substitutions (e.g., L89W) reduce the closed-state stability, lowering activation thresholds .

MutationEffect
N103C (MTSSL)Stabilizes expanded pore conformation; reduces lipid access to TM pockets
L89WDestabilizes closed state; enhances channel activation under tension

Modulation by Agonists and Inhibitors

MscL is activated by small molecules targeting the S1-TM2 interface:

CompoundMechanismEffect
SCH-79797Binds near TM2, disrupting lipid interactionsActivates channel; bactericidal
CurcuminIndirect activation; enhances membrane permeabilizationInhibits bacterial growth
GadoliniumBlocks pore in closed stateInhibits channel activity

These compounds highlight MscL’s potential as an antimicrobial target .

Expression and Reconstitution

MscL is expressed in E. coli as a GST fusion protein, purified via glutathione affinity chromatography, and cleaved with thrombin to yield the native protein . Functional reconstitution into liposomes confirms:

  • Conductance: ~3 nS in the open state.

  • Pressure Sensitivity: Activated by membrane tension (~10 mN/m).

  • Inhibition: Blocked by gadolinium (Gd³⁺) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mscL; BTH_I2079; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-143
Protein Length
full length protein
Species
Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264)
Target Names
mscL
Target Protein Sequence
MSIIKEFKEFAVKGNVMDLAIGVIIGGAFSKIVDSVVKDLIMPVIGVLTGGLDFSNKFVL LGQIPASFKGNPESFKDLQAAGVATFGYGSFITVLINFIILAFIIFLMVKFINKLRKPEE AAPAATPEDVLLLREIRDSLKQR
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the Burkholderia thailandensis MscL protein and what is its physiological role?

    The Large-conductance mechanosensitive channel (MscL) in B. thailandensis is a pore-forming membrane protein that responds to mechanical stress in the cell membrane. It functions as a stretch-activated osmotic release valve, opening in response to membrane tension to prevent cell lysis during osmotic shock . The channel forms a homopentamer with each subunit containing two transmembrane regions. When open, MscL has a large conductance (approximately 3 nS), making it permeable to ions, water, and small proteins . In B. thailandensis, as in other bacteria, MscL is upregulated during stationary phase and osmotic shock conditions to protect cellular integrity .

  • What expression systems are commonly used for recombinant B. thailandensis MscL production?

    E. coli is the predominant expression system for recombinant production of B. thailandensis MscL. The protein is typically expressed with an N-terminal His-tag to facilitate purification . The expression construct generally includes the full-length MscL protein (amino acids 1-143) cloned into an appropriate expression vector. After expression, the protein can be purified using affinity chromatography and is often supplied as a lyophilized powder that requires reconstitution in an appropriate buffer system, typically containing 6% trehalose at pH 8.0 . Storage recommendations include keeping aliquots at -20°C to -80°C and avoiding repeated freeze-thaw cycles.

Experimental Data and Resources

  • What characterized properties should researchers expect when working with recombinant B. thailandensis MscL?

    When working with recombinant B. thailandensis MscL, researchers should expect the following properties:

    PropertyCharacteristicNotes
    Protein length143 amino acidsFull-length protein
    Molecular weight~15-16 kDa per monomer~75-80 kDa for pentameric complex
    Oligomeric statePentamerForms homopentameric complex
    Conductance~3 nSOne of the largest conductances among ion channels
    Gating threshold~10-12 mN/mMembrane tension required for opening
    Storage stabilityStable at -20°C/-80°CAvoid repeated freeze-thaw cycles
    Buffer compatibilityTris/PBS-based, pH 8.0Contains 6% trehalose as stabilizer
    Reconstitution0.1-1.0 mg/mLIn deionized sterile water
    Purification tagN-terminal His-tagFacilitates purification by metal affinity chromatography

    For electrophysiological studies, researchers typically incorporate purified MscL into liposomes or planar lipid bilayers. The channel exhibits voltage-independent gating and is primarily activated by membrane tension, with a characteristic large conductance that allows passage of ions and small molecules up to ~30 Å in diameter when fully open .

  • What genetic resources and tools are available for studying MscL in B. thailandensis?

    Researchers have access to various genetic resources and tools for studying MscL in B. thailandensis:

    Resource TypeExamplesApplications
    Genome sequenceB. thailandensis E264 complete genomeGene identification, primer design
    Expression vectorspUC18miniTn7T-based vectorsComplementation, overexpression
    Selectable markerssacB, pheS, gat, dhfRSelection for recombinants
    Promoter systemsP<sub>s12</sub>, P<sub>lac</sub>Constitutive or inducible expression
    Recombineering systemsλ Red proteinsTargeted mutagenesis
    Natural transformationPCR transformation protocolsGene knockout and replacement
    Transposon systemsMini-Tn7, Tn5 derivativesSite-specific or random mutagenesis
    Fluorescent taggingBONCATProtein labeling and visualization

    The availability of these tools enables comprehensive genetic manipulation of B. thailandensis, including targeted gene knockouts, complementation studies, and protein expression analyses. Particularly useful are the natural competence-based methods and λ Red recombineering systems that allow for efficient genetic modifications with relatively small PCR products, reducing the number of primers and amplification steps required .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.