Recombinant Burkholderia thailandensis Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant MsbA from B. thailandensis is a full-length (1-596 amino acids) ABC transporter fused with an N-terminal His tag for purification. Key specifications include:

PropertyDetails
UniProt IDQ2SZW0
Gene NamemsbA
Source OrganismBurkholderia thailandensis
Expression HostEscherichia coli
Purity>90% (SDS-PAGE)
Storage-20°C/-80°C in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water; glycerol (5–50%) for long-term storage

3.1. Mechanistic Studies

MsbA serves as a model ABC transporter for investigating:

  • Substrate Transport Dynamics: Real-time analysis of lipid A flipping using fluorescence quenching assays .

  • PMF Dependency: Collaboration with DedA family proteins (e.g., DbcA) to maintain membrane potential for lipid A modification .

3.2. Drug Development

  • Antibiotic Adjuvants: Targeting MsbA could disrupt LPS assembly, sensitizing bacteria to polymyxins .

  • Structural Mimicry: Engineered MsbA variants aid in designing inhibitors against homologous human ABC transporters .

Comparative Analysis with Burkholderia pseudomallei MsbA

The B. pseudomallei homolog (UniProt: Q63VX7) shares 98% sequence identity but differs in:

  • Amino Acid Residues: Position 284 (VMITLVRDS vs. VTITLVRDS) .

  • Operon Organization: Distinct transcriptional regulation of Ara4N biosynthesis genes .

Technical Notes for Experimental Use

  • Avoid Freeze-Thaw Cycles: Aliquot protein to prevent aggregation .

  • Activity Assays: Use PMF-generating systems (e.g., NADH oxidase) to mimic physiological conditions .

Future Directions

  • Cryo-EM Studies: High-resolution structural snapshots of MsbA during ATP hydrolysis.

  • In Vivo Functional Analysis: Gene knockout models to elucidate crosstalk with Ara4N biosynthesis pathways .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. Kindly consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. The shelf life for the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
msbA; BTH_I0985; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-596
Protein Length
full length protein
Species
Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264)
Target Names
msbA
Target Protein Sequence
MSVKPTLSKPIGGQDASSPAVVMRRLWPYVKPLVWVLVAGVLAMAAVAATEAGIPALLKP LLDHGFGSKGDMTTKLYVPAAVVGLALARAIAQYASGYLLQYVSNRILLDLRIQMFERMI HTGVSFFQRETASTVINAVVFEVNQVLSVLMGVMITLVRDSLTVVFLLGYLFYLNWRLTL IVAILLPCIGWLVGKINRRLRRLNREHQTLTNQLAYIVEETVGGYKVVKVHNGESYEIGR FNELSRKLRGYSMRMTVSGGLAQPLTQFLASIALAVVLTIAVVQSSNDQTTVGGFVAFVT AMLLIISPLKHLMDVNQPLQRGMTAAELIFGLIDEPREPEGGGKPLARASGAIEFSHVSF SYGISRDGRQTLDDVSFTVAPGEMVALAGPSGSGKTTLVNLLPRFFDPSSGTVRVDGVAL PEYSLHDLRNQIAMVSQDVVLFNDTIAANVAYGQTPERDGVEAALRAANLWETVTAMPDG IDTLVGDNGMRLSGGQRQRLAIARAIYKDAPILILDEATSALDSESERHVQAALETLMKG RTTLVIAHRLSTIERADRILVLEGGKIVESGSHRELLEQGGLYAHLHRIQFQQDAG
Uniprot No.

Target Background

Function
This protein is involved in lipopolysaccharide (LPS) biosynthesis. It translocates lipid A-core from the inner to the outer leaflet of the inner membrane. Transmembrane domains (TMD) form a pore in the inner membrane, and the ATP-binding domain (NBD) is responsible for energy generation.
Database Links
Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the key structural components of recombinant Burkholderia thailandensis MsbA?

The recombinant version of B. thailandensis MsbA is typically produced with specific modifications to facilitate research applications:

  • N-terminal His-tag: Enables efficient purification using metal affinity chromatography

  • Full-length protein (1-596 amino acids): Preserves complete functional domains

  • Expression system: E. coli-based expression for high yield and proper folding

  • Physical form: Supplied as lyophilized powder for stability

The protein contains several key structural elements:

  • Transmembrane domains: Form the substrate translocation pathway

  • Nucleotide-binding domains (NBDs): Responsible for ATP binding and hydrolysis

  • Coupling helices: Transmit conformational changes between NBDs and transmembrane domains

  • Substrate-binding pocket: Accommodates lipid A and potentially other substrates

How do storage conditions affect the stability and functionality of recombinant MsbA?

Storage ParameterRecommended ConditionRationale
Storage temperature-20°C/-80°CMinimizes protein degradation and maintains structural integrity
Physical stateLyophilized or aliquoted solutionLyophilization extends shelf-life; aliquoting prevents repeated freeze-thaw cycles
Buffer compositionTris/PBS-based buffer with 6% Trehalose, pH 8.0Trehalose serves as a cryoprotectant; pH 8.0 optimizes stability
Reconstitution0.1-1.0 mg/mL in deionized sterile waterEnsures proper solubilization while maintaining protein concentration
Additives for long-term storage5-50% glycerol (recommended: 50%)Prevents ice crystal formation that can denature protein
Handling precautionsCentrifuge vial before opening; avoid repeated freeze-thaw cyclesEnsures recovery of all material; preserves protein structure

Working aliquots may be stored at 4°C for up to one week, but longer periods require proper freezing at -20°C/-80°C. These storage guidelines are critical for maintaining the conformational integrity necessary for accurate structural and functional studies .

How does ATP hydrolysis drive the conformational changes in MsbA required for substrate transport?

ATP hydrolysis powers a complex cycle of conformational changes in MsbA that facilitates substrate translocation across the membrane. This mechanism involves:

  • Initial state: In the absence of nucleotides, the two ATP-binding cassettes (ABCs) are substantially separated.

  • ATP binding: When ATP binds, it induces dimerization of the NBDs.

  • Conformational propagation: This dimerization triggers large-scale conformational changes throughout the protein, with movements of opposite signs in the periplasmic and cytoplasmic regions of the transporter.

  • ATP hydrolysis: Hydrolysis of ATP results in a dramatic 33-Å distance change between the two ABCs, significantly altering the substrate-binding chamber configuration.

  • Post-hydrolysis state: The formation of this intermediate conformation is crucial for the transport cycle and leads to reorientation of the substrate-binding site.

  • Alternating access: These conformational changes create an alternating access mechanism where the substrate binding chamber sequentially opens to opposite sides of the membrane.

The energy from ATP is thus converted into mechanical work that enables the 10-20-Å conformational changes necessary for translocation of lipid A across the membrane barrier .

What is the relationship between LPS binding and conformational changes in MsbA?

LPS binding induces distinct structural changes in MsbA that are integral to the transport mechanism:

  • Specific conformational signature: LPS binding creates a unique conformational state that is distinguishable from the apo (unbound) state.

  • Interplay with ATP cycle: Research demonstrates that LPS-induced structural changes are inhibited when the transporter is trapped in an ATP post-hydrolysis intermediate. This suggests a sequential mechanism where ATP hydrolysis and LPS binding must occur in a coordinated manner.

  • Sequential binding model: The conformational data supports a model where:

    • LPS is first sequestered into an open cytoplasmic chamber

    • Subsequent ATP-driven conformational changes reorient this chamber

    • This reorientation facilitates LPS translocation across the membrane

  • Magnitude of changes: Experimental evidence shows that LPS binding triggers conformational adjustments that work in concert with the larger ATP-driven changes (10-20-Å) to complete the transport cycle.

These findings highlight the sophisticated allosteric coupling between substrate binding and nucleotide hydrolysis that enables efficient lipid A transport .

What methodologies are most effective for studying conformational changes in MsbA during the transport cycle?

Research on MsbA conformational dynamics employs multiple complementary techniques:

MethodologyApplication to MsbASpecific AdvantagesLimitations
Pulse Double Electron-Electron Resonance (DEER)Measures precise distances between spin-labeled residuesProvides long-range distance constraints (20-80Å); works in membrane environmentsRequires site-directed spin labeling; potentially perturbing
Fluorescence HomotransferDetects proximity and orientation of labeled domainsCan be performed in real-time; sensitive to subtle changesLimited distance range; potential for fluorophore interference
X-ray CrystallographyProvides high-resolution static structuresAtomic resolution of protein structuresDifficult to capture transient states; crystal packing artifacts
Cryo-Electron MicroscopyVisualizes different conformational statesCan capture multiple conformations; no crystals neededLower resolution than crystallography; sample preparation challenges
Molecular Dynamics SimulationsModels conformational transitionsProvides dynamic information at atomic levelComputational limitations; force field accuracy
Site-Directed MutagenesisTests functional importance of specific residuesDirect correlation with functional outcomesIndirect structural information; potential for global effects
Hydrogen-Deuterium Exchange MSMaps solvent accessibility changesNo labeling required; identifies flexible regionsLimited spatial resolution; complex data analysis

For comprehensive understanding, researchers should employ multiple orthogonal methods. The DEER and fluorescence homotransfer approaches have proven particularly valuable for revealing the large-scale conformational changes between the two ABC domains and the alternating accessibility of the transport chamber .

What expression systems and purification strategies yield optimal results for functional studies of recombinant MsbA?

The selection of appropriate expression and purification protocols is critical for obtaining functionally active MsbA:

Expression Systems:

  • E. coli: Most commonly used for recombinant MsbA expression

    • Advantages: Rapid growth, high yields, well-established protocols

    • Recommended strains: BL21(DE3), C41(DE3), or C43(DE3) for membrane proteins

    • Induction conditions: 0.5-1.0 mM IPTG at reduced temperatures (18-25°C) to improve folding

  • Alternative systems to consider for specific applications:

    • Insect cells: Better for complex folding requirements

    • Cell-free systems: Rapid production and direct incorporation into liposomes

Purification Strategy:

  • Membrane preparation:

    • Gentle lysis (sonication or French press)

    • Differential centrifugation to isolate membranes

    • Solubilization in appropriate detergents (DDM, LMNG, or UDM)

  • Affinity chromatography:

    • Ni-NTA for His-tagged constructs

    • Wash with low imidazole concentrations (20-40 mM)

    • Elute with gradient or step gradient (250-500 mM imidazole)

  • Secondary purification:

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for further purification

  • Quality control assessments:

    • SDS-PAGE (>90% purity required)

    • ATPase activity assays to confirm functionality

    • Dynamic light scattering to verify monodispersity

  • Storage recommendations:

    • Lyophilization with 6% trehalose

    • Reconstitution in deionized water (0.1-1.0 mg/mL)

    • Addition of 5-50% glycerol for frozen storage

    • Aliquoting to avoid repeated freeze-thaw cycles

This systematic approach maximizes the yield of functionally active protein suitable for structural and biochemical studies .

How should researchers design experiments to correlate structural dynamics with transport function in MsbA?

Designing robust experiments to establish structure-function relationships requires careful consideration of multiple factors:

  • Selection of reporter positions:

    • Strategic placement of probes at key interfaces (NBD-NBD, NBD-TMD)

    • Selection of residues that don't disrupt function (surface-exposed)

    • Pairs of positions that undergo significant movement during transport

  • Functional validation:

    • ATPase activity assays of labeled constructs

    • Transport assays in reconstituted systems

    • Comparison with wild-type protein to ensure minimal perturbation

  • Experimental conditions matrix:

    ConditionRationaleControls
    Apo (no nucleotide)Baseline conformationBuffer-only
    ATP-boundPre-hydrolysis stateNon-hydrolyzable ATP analogs (AMP-PNP)
    ADP-boundPost-hydrolysis stateADP + Pi
    Transition stateCatalytic intermediateVanadate-trapped (ADP-Vi)
    LPS-boundSubstrate effectVarying LPS concentrations
    ATP+LPSCombined effectSequential addition experiments
  • Time-resolved measurements:

    • Stopped-flow fluorescence for millisecond timescale

    • Rapid mixing with ATP followed by different incubation times

    • Synchronization strategies (e.g., caged-ATP photolysis)

  • Reconstitution systems:

    • Detergent micelles for basic characterization

    • Nanodiscs for defined bilayer environment

    • Liposomes for directional transport assays

  • Correlation analysis:

    • Plotting structural parameters against functional readouts

    • Statistical methods to establish significance of correlations

    • Multi-variate analysis for complex datasets

This integrated approach enables researchers to establish causal relationships between specific conformational changes and functional outcomes in the MsbA transport cycle .

What are the critical controls and variables in studying ATP-dependent conformational changes in MsbA?

Rigorous control experiments are essential for reliable interpretation of conformational studies:

Critical Controls:

  • Nucleotide-state controls:

    • ATP with magnesium (active catalysis)

    • ATP without magnesium (binding without hydrolysis)

    • Non-hydrolyzable analogs (AMP-PNP, ATP-γ-S)

    • Transition state analogs (ADP+Vanadate)

    • ADP+Pi (post-hydrolysis products)

  • Protein controls:

    • Catalytically inactive mutants (e.g., Walker B mutation E504Q)

    • Substrate-binding mutants

    • Wild-type protein without labels/modifications

    • Heat-denatured protein (negative control)

  • Environmental controls:

    • Detergent-only samples

    • Empty nanodiscs/liposomes

    • Buffer composition variations

    • Temperature dependence measurements

Key Variables to Systematically Test:

  • Nucleotide conditions:

    • ATP concentration series (0.1-10 mM)

    • Mg²⁺ concentration (1-10 mM)

    • ATP:protein molar ratio (1:1 to 100:1)

  • Substrate variables:

    • LPS concentration series

    • LPS structural variants

    • Order of addition (LPS before/after ATP)

  • Membrane environment:

    • Detergent type and concentration

    • Lipid composition in nanodiscs/liposomes

    • Cholesterol content

    • Membrane curvature (liposome size)

  • Temporal variables:

    • Incubation time with nucleotides

    • Temperature effects on reaction rates

    • Steady-state vs. pre-steady-state measurements

  • Data analysis considerations:

    • Multiple replicates (n≥3)

    • Statistical significance testing

    • Control for batch-to-batch variation

    • Model-free vs. model-dependent analysis

This comprehensive approach to experimental controls and variables enables robust interpretation of conformational dynamics data in relation to MsbA's ATP-dependent transport mechanism .

How does the conformational cycle of Burkholderia thailandensis MsbA compare with bacterial homologs and human ABC transporters?

MsbA serves as a valuable model for understanding the broader ABC transporter superfamily:

Comparison with Bacterial Homologs:

  • E. coli and Salmonella MsbA:

    • Core mechanism is conserved (ATP-driven conformational changes)

    • Similar magnitude of NBD separation (30-35Å)

    • Species-specific differences in substrate specificity reflect variations in LPS structure

    • Sequence conservation highest in NBDs, more divergent in substrate-binding regions

  • Other bacterial ABC transporters:

    • Sav1866 (S. aureus): Similar "twisting" motion during transport cycle

    • BtuCD (E. coli): Different coupling mechanism between NBDs and TMDs

    • MacB (E. coli): Mechanistically distinct "periplasmic sweeping" transport

Relationship to Human ABC Transporters:

  • P-glycoprotein (ABCB1):

    • Significant sequence similarity to MsbA (structural homolog)

    • Similar ATP-driven conformational changes

    • Critical differences in substrate-binding pocket reflecting broader substrate range

    • Both involved in extrusion of hydrophobic molecules (different specificities)

  • CFTR (ABCC7):

    • Shares ATP-binding and hydrolysis mechanism

    • Unique channel-like function versus MsbA's flippase activity

    • Contains regulatory domains absent in MsbA

  • Clinical relevance:

    • MsbA and human multidrug ABC transporters share fundamental mechanisms

    • Insights from MsbA conformational studies inform understanding of drug resistance mechanisms

    • Bacterial transporters provide simplified systems for testing ABC transporter inhibitors

The 33-Å distance change measured between NBDs in MsbA is consistent with the dimerization-dissociation cycle observed in human ABC transporters, suggesting evolutionary conservation of core mechanical principles despite diversification of substrate specificity and regulatory mechanisms .

What are the implications of MsbA conformational dynamics for the development of novel antimicrobial strategies?

Understanding MsbA's conformational cycle creates opportunities for antimicrobial development:

  • Targeting critical conformational states:

    • Inhibitors that trap MsbA in non-functional conformations

    • Compounds that prevent the 33-Å NBD movement required for transport

    • Molecules that disrupt the coupling between ATP hydrolysis and conformational changes

  • Rational drug design approaches:

    • Structure-based design targeting transient pockets that appear during the conformational cycle

    • Molecules that compete with LPS binding

    • Allosteric inhibitors that lock the transporter in specific conformations

  • Specificity considerations:

    • Targeting unique aspects of bacterial MsbA not present in human homologs

    • Exploiting differences in the conformational dynamics between MsbA and human ABC transporters

    • Species-specific variations in MsbA structure for narrow-spectrum antibiotics

  • Potential impact on bacterial viability:

    • MsbA inhibition disrupts outer membrane biogenesis

    • Synergistic effects with other antimicrobials targeting cell envelope

    • Decreased resistance to host defense mechanisms

  • Combination therapy potential:

    • MsbA inhibitors could sensitize bacteria to conventional antibiotics

    • Targeting multiple steps in LPS biosynthesis and transport pathway

    • Reducing emergence of resistance through multi-target approach

Research on MsbA conformational dynamics thus provides a foundation for developing novel antimicrobials that exploit the critical role of this transporter in Gram-negative bacterial cell envelope biogenesis .

How can researchers effectively interpret contradictory findings in MsbA structural studies?

Resolving contradictions in structural data requires systematic analysis:

  • Methodological considerations:

    • Different techniques have inherent limitations and biases

    • Crystal structures may capture non-physiological conformations due to crystal packing

    • Detergent effects may distort native membrane protein conformations

    • Time-scale differences between methods may capture different parts of the conformational ensemble

  • Experimental conditions impact:

    FactorPotential Effect on ConformationResolution Approach
    Detergent/lipid environmentAltered packing of transmembrane helicesSystematic comparison across conditions
    TemperatureChanged dynamics and population distributionsTemperature-series experiments
    pHModified electrostatic interactionspH titration studies
    Salt concentrationAffected screening of charged residuesIonic strength variation
    Protein modificationsPerturbed native structureMinimal-modification constructs
  • Integrative structural biology approach:

    • Combining multiple techniques with complementary strengths

    • Weighting data by reliability and resolution

    • Computational modeling to reconcile diverse datasets

    • Ensemble representations rather than single structures

  • Functional correlation:

    • Prioritizing conformations that explain functional data

    • Transport assays to validate physiological relevance

    • Mutagenesis to test specific structural hypotheses

  • Unified conceptual framework:

    • MsbA likely exists in multiple conformational states in equilibrium

    • Apparent contradictions may reflect different states in a complex cycle

    • Nucleotide state and substrate binding shift these equilibria

    • Intermediates may be differentially captured by various methods

This systematic approach to interpreting structural data allows researchers to build more comprehensive models of the MsbA transport cycle that accommodate apparently conflicting observations from different experimental techniques .

What emerging technologies could advance our understanding of MsbA structure and function?

Several cutting-edge methodologies show promise for addressing current knowledge gaps:

  • Advanced structural techniques:

    • Time-resolved cryo-EM to capture transient conformational states

    • Micro-electron diffraction for structure determination from microcrystals

    • X-ray free-electron lasers for room-temperature, radiation-damage-free structures

    • Integrative/hybrid methods combining multiple structural data sources

  • Single-molecule approaches:

    • Single-molecule FRET to track conformational dynamics in real-time

    • Force spectroscopy to measure energy landscapes of conformational changes

    • Single-particle tracking in native membranes

    • Zero-mode waveguides for observing substrate transport events

  • Native environment preservation:

    • Styrene-maleic acid lipid particles (SMALPs) for detergent-free purification

    • Nanodiscs with native lipid compositions

    • Spheroid-supported bilayers for directional transport assays

    • In-cell structural biology approaches

  • Computational methods:

    • Enhanced sampling molecular dynamics to access longer timescales

    • Machine learning for predicting conformational changes and substrate interactions

    • Quantum mechanical/molecular mechanical (QM/MM) methods for catalytic mechanism

  • Functional genomics:

    • CRISPR-based screens for identifying genetic interactions

    • Deep mutational scanning to comprehensively map structure-function relationships

    • In vivo chemical crosslinking mass spectrometry

These emerging technologies will enable researchers to build more complete models of MsbA function by addressing current limitations in temporal resolution, environmental authenticity, and the ability to connect structural states with functional outcomes .

What are the most significant unresolved questions regarding MsbA conformational dynamics?

Despite significant progress, several fundamental questions remain unanswered:

  • Substrate recognition mechanism:

    • How does MsbA specifically recognize lipid A among membrane lipids?

    • What is the precise binding site and orientation of lipid A?

    • How do mutations in the binding pocket affect substrate specificity?

  • Energy transduction pathway:

    • How is ATP hydrolysis energy precisely coupled to substrate movement?

    • What is the sequence and timing of conformational changes during transport?

    • Which residues form the critical communication pathway between NBDs and substrate-binding site?

  • Intermediate states:

    • What conformational intermediates exist between major states?

    • How stable are these intermediates under physiological conditions?

    • Are there parallel pathways or obligatory sequences in the transport cycle?

  • Regulatory mechanisms:

    • How is MsbA activity regulated in response to cellular conditions?

    • Do post-translational modifications affect transport efficiency?

    • How does membrane composition influence conformational dynamics?

  • Evolutionary adaptation:

    • How have conformational dynamics adapted for species-specific lipid A structures?

    • What structural features distinguish MsbA from drug-transporting ABC proteins?

    • How do pathogenic bacteria modify MsbA function under selective pressure?

Addressing these questions will require integration of structural, biochemical, computational, and cellular approaches to build a comprehensive understanding of MsbA's role in bacterial membrane biogenesis .

How might research on Burkholderia thailandensis MsbA contribute to broader understanding of membrane transport mechanisms?

B. thailandensis MsbA research has wide-ranging implications:

  • ABC transporter mechanism elucidation:

    • MsbA serves as a model system for the ABC transporter superfamily

    • The 33-Å distance change between NBDs likely represents a conserved mechanical principle

    • Insights from MsbA can inform understanding of related human transporters involved in disease

  • Membrane protein conformational dynamics:

    • General principles for coupling ATP hydrolysis to membrane protein conformational changes

    • Methods for studying large-scale movements in membrane proteins

    • Understanding lipid-protein interactions during transport cycles

  • Bacterial physiology and pathogenesis:

    • Role of efficient LPS transport in outer membrane biogenesis

    • Impact on bacterial survival in host environments

    • Connections to virulence and host immune recognition

  • Drug development applications:

    • Template for designing inhibitors of related bacterial transporters

    • Strategies for targeting conformational intermediates in ABC transporters

    • Approaches for modulating transport efficiency as antimicrobial strategy

  • Methodological advancements:

    • Validation of biophysical techniques for membrane protein dynamics

    • Integration of structural and functional assays

    • Development of computational models for transporter function

The conformational dynamics of MsbA thus serve as a paradigm for understanding fundamental principles of membrane transport that extend beyond this specific system to the broader field of membrane protein biology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.