Recombinant Burkholderia thailandensis Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Lipoprotein Processing

lspA catalyzes the cleavage of signal peptides from lipoproteins, a critical step in bacterial membrane biogenesis. In B. thailandensis, this enzyme processes lipoproteins at the conserved lipobox motif, specifically cleaving after the cysteine residue . Lipoproteins are essential for virulence, nutrient acquisition, and cell envelope integrity in related pathogenic Burkholderia species, suggesting lspA’s broader role in bacterial survival .

Proteomic and Transcriptomic Regulation

Multi-omic studies demonstrate that lspA expression in B. thailandensis is modulated under stress conditions:

  • Low-Dose Antibiotic Exposure: Trimethoprim (Tmp) induces proteomic changes linked to folate metabolism, though lspA itself is not directly upregulated .

  • Quorum Sensing: While lspA is not part of the acyl-homoserine lactone (AHL) regulon, its activity may intersect with QS-controlled pathways governing secondary metabolism .

Applications in Biotechnology

Recombinant B. thailandensis lspA serves as a safe surrogate for studying lipoprotein processing in pathogenic Burkholderia species. Its applications include:

  • Vaccine Development: Engineered B. thailandensis strains expressing modified lipopolysaccharides (LPS) could inform subunit vaccine design for glanders and melioidosis .

  • Enzyme Engineering: Structural models enable rational design of lspA variants with altered substrate specificity .

Future Directions

Key unresolved questions include:

  • Structural Resolution: X-ray crystallography or cryo-EM of recombinant lspA is needed to validate AlphaFold predictions .

  • Inhibitor Screens: Testing compound libraries against recombinant lspA could identify lead molecules for antibiotic development .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please specify it, and we will prioritize its development.
Synonyms
lspA; BTH_I0769; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264)
Target Names
lspA
Target Protein Sequence
MAKTLSKSSGGALAPWLGISLIVILFDQLTKIAVLKTFAYGAMHQLTPFFNLTLIYNRGA AFGFLATAGGWQRWAFTALGIGATLVICYLLKRHGHQRLFSLSLALILGGALGNVIDRLI YGHVIDFLDFHVGAWHWPAFNLADSAITVGAVLLIYDELRRVRGAR
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Lipoprotein signal peptidase (LspA) and what role does it play in Burkholderia thailandensis?

Lipoprotein signal peptidase (LspA) is an essential aspartyl protease in gram-negative bacteria that cleaves the transmembrane helix signal peptide of lipoproteins as part of the lipoprotein-processing pathway. In Burkholderia thailandensis, as in other gram-negative bacteria, LspA plays a crucial role in processing lipoproteins that contribute to cell envelope integrity and bacterial virulence . The enzyme functions by recognizing lipid-modified prolipoproteins and cleaving their signal peptides, allowing mature lipoproteins to be properly localized within the bacterial cell envelope.

LspA is considered an excellent target for the development of antibiotic therapeutics because it is essential in gram-negative bacteria and important for virulence in gram-positive bacteria. Additionally, its highly conserved active site suggests that resistance mutations would likely interfere with normal substrate binding and cleavage, making development of resistance less likely .

How does the structure of B. thailandensis LspA compare with LspA from other bacterial species?

While the specific crystal structure of B. thailandensis LspA has not been fully characterized in the provided research, structural studies of LspA from related species provide valuable insights. LspA structures from Pseudomonas aeruginosa (LspPae) and Staphylococcus aureus (LspMrs) have been determined with antibiotic globomycin bound .

The core structural features likely preserved in B. thailandensis LspA include:

  • A catalytic dyad of aspartate residues in the active site

  • A highly conserved periplasmic helix (PH) that undergoes conformational changes during substrate binding

  • A β-cradle structure that works with the PH to "clamp" substrates in place

  • Approximately 14 highly conserved residues surrounding the active site

B. thailandensis LspA would be expected to share these fundamental structural elements while potentially exhibiting species-specific variations that could affect substrate specificity or binding dynamics.

What experimental approaches are recommended for expression and purification of recombinant B. thailandensis LspA?

Based on successful protocols for other bacterial LspA proteins, the following methodological approach is recommended for recombinant B. thailandensis LspA:

  • Gene cloning and vector construction:

    • Clone the B. thailandensis LspA gene into an expression vector (e.g., pET28b) with an N-terminal 6xHis tag and thrombin cleavage sequence

    • Confirm correct sequence through DNA sequencing

  • Protein expression:

    • Transform the construct into an appropriate E. coli expression strain

    • Induce protein expression under optimized conditions (temperature, IPTG concentration, duration)

    • For membrane proteins like LspA, lower induction temperatures (16-20°C) may improve proper folding

  • Protein purification:

    • Lyse cells and solubilize membrane fractions using appropriate detergents (FC12 has been successfully used for LspA from P. aeruginosa)

    • Purify using nickel affinity chromatography

    • Consider additional purification steps such as size exclusion chromatography

  • Protein verification:

    • Confirm protein identity and purity through SDS-PAGE and Western blotting

    • Verify proper folding using circular dichroism or other biophysical methods

This approach is based on established protocols for other LspA proteins and may require optimization for B. thailandensis-specific characteristics.

What methods are most effective for studying the conformational dynamics of B. thailandensis LspA?

Research on LspA conformational dynamics benefits from a hybrid experimental approach combining computational and spectroscopic methods:

  • Molecular Dynamics (MD) Simulations:

    • Simulate LspA in a lipid bilayer environment to observe natural conformational changes

    • Track the movement of specific domains, particularly the periplasmic helix which fluctuates on the nanosecond timescale

    • Generate structural models of different conformational states

  • Electron Paramagnetic Resonance (EPR) Spectroscopy:

    • Introduce cysteine residues at strategic positions for spin labeling

    • Use continuous-wave (CW) EPR to measure mobility of specific regions

    • Employ Double Electron-Electron Resonance (DEER) to measure distances between labeled sites

    • Compare experimental distance distributions with those predicted by MD simulations

  • Site-directed mutagenesis:

    • Introduce mutations at conserved residues to assess their role in conformational changes

    • Combine with functional assays to correlate structural changes with enzymatic activity

This hybrid approach has successfully revealed that the periplasmic helix of LspA undergoes conformational dynamics in the nanosecond time regime, with the β-cradle and periplasmic helix coming as close as 6.2 Å apart in the most closed conformation, completely occluding the charged active site residues .

How does antibiotic binding affect the structure and function of B. thailandensis LspA?

Antibiotic binding to LspA induces significant conformational changes that inhibit its enzymatic function. Based on studies with the antibiotic globomycin:

  • Conformational Changes:

    • Globomycin binding stabilizes an intermediate conformation of the periplasmic helix

    • This intermediate state differs from both the fully closed (apo) and fully open states

    • Multiple binding modes are possible, with the dominant conformation showing a more open periplasmic helix configuration than the apo state

  • Mechanism of Inhibition:

    • The antibiotic-stabilized conformation inhibits both signal peptide cleavage and substrate binding

    • The intermediate state prevents proper positioning of the substrate in the active site

    • The altered conformation disrupts the catalytic function of the aspartyl protease active site

  • Specificity Considerations:

    • The extensive conservation of residues surrounding the active site suggests that resistance mutations that would impede antibiotic binding would also likely interfere with normal substrate binding

This mechanistic understanding has important implications for developing new antibiotics targeting LspA from pathogenic Burkholderia species.

What is currently known about the substrate specificity of B. thailandensis LspA compared to other Burkholderia species?

While specific substrate profiles for B. thailandensis LspA have not been fully characterized in the provided research, comparative analysis with other Burkholderia species offers valuable insights:

  • Structural Adaptability:

    • LspA generally exhibits a flexible and adaptable active site that accommodates various lipoprotein substrates

    • The periplasmic helix and β-cradle form a "clamp" that can adjust to different substrates

  • Comparison with Related Burkholderia Species:

    • B. thailandensis and B. pseudomallei share significant genomic similarities but differ in pathogenicity

    • Studies of lipopolysaccharides (LPS) from both species show that B. pseudomallei lipid A has unique features not found in B. thailandensis, including substitution with fatty acid C14:0(2-OH)

    • These species-specific differences in cell envelope components suggest there may also be differences in lipoprotein processing machinery, including LspA specificity

  • Methodological Approach to Study Specificity:

    • Researchers should consider comparative substrate profiling using recombinant LspA from different Burkholderia species

    • Techniques such as mass spectrometry-based proteomics can identify and compare processed lipoproteins

    • Isothermal titration calorimetry (ITC) can determine binding affinities for different substrates

The biochemical differences between Burkholderia species may reflect adaptations to different environmental niches and pathogenic potentials, with implications for LspA substrate recognition and processing.

What are the major challenges in crystallizing B. thailandensis LspA and how can they be addressed?

Crystallizing membrane proteins like LspA presents several technical challenges:

  • Challenges in Membrane Protein Crystallization:

    • Low expression yields of functional protein

    • Detergent selection that maintains protein stability while facilitating crystal contacts

    • Conformational heterogeneity that hampers crystal formation

    • Difficulty capturing different functional states (apo, substrate-bound, etc.)

  • Methodological Solutions:

    • Protein Engineering Approaches:

      • Generate fusion constructs with crystallization chaperones (e.g., T4 lysozyme)

      • Introduce surface mutations to enhance crystal contacts

      • Create truncated constructs to remove flexible regions

    • Crystallization Strategies:

      • Employ lipidic cubic phase (LCP) crystallization methods specialized for membrane proteins

      • Screen multiple detergents and lipid-detergent mixtures

      • Utilize nanobodies or antibody fragments to stabilize specific conformations

      • Consider co-crystallization with substrate analogs or inhibitors like globomycin to capture functional states

    • Alternative Structural Methods:

      • Complement crystallography with cryo-electron microscopy

      • Use small-angle X-ray scattering (SAXS) to characterize protein shape in solution

      • Continue employing hybrid approaches with MD and EPR as demonstrated for other LspA proteins

To date, crystal structures of LspA have been determined for P. aeruginosa and S. aureus with antibiotics bound, but apo and lipoprotein-bound structures remain elusive, highlighting the technical challenges involved .

How can researchers efficiently measure the enzymatic activity of recombinant B. thailandensis LspA?

Assessing LspA enzymatic activity requires specialized approaches due to its membrane-embedded nature and specific substrate requirements:

  • In vitro Activity Assays:

    • Fluorogenic Peptide Substrates:

      • Design fluorescence resonance energy transfer (FRET) peptides mimicking natural signal peptide cleavage sites

      • Measure fluorescence increase upon cleavage in detergent micelles or reconstituted proteoliposomes

    • Mass Spectrometry-Based Assays:

      • Incubate recombinant LspA with synthetic prolipopeptide substrates

      • Analyze reaction products using liquid chromatography-mass spectrometry (LC-MS)

      • Quantify substrate depletion and product formation rates

  • Cell-Based Activity Assays:

    • Complementation Studies:

      • Express B. thailandensis LspA in LspA-deficient bacterial strains

      • Assess restoration of growth or specific phenotypes

    • Reporter Systems:

      • Design fusion constructs of lipoprotein substrates with reporter proteins

      • Monitor processing through changes in reporter localization or activity

  • Inhibition Studies:

    • Use known LspA inhibitors like globomycin as positive controls

    • Establish dose-response relationships for inhibition

    • Compare inhibition profiles across different Burkholderia species and strains

These activity assays provide essential tools for characterizing wild-type and mutant LspA enzymes, as well as for screening potential inhibitors for antibiotic development.

How can B. thailandensis LspA be utilized in antibiotic screening and development?

B. thailandensis LspA represents a valuable target for antibiotic development, with several strategic advantages:

  • Target Validation Considerations:

    • LspA is essential in Gram-negative bacteria like Burkholderia species

    • It contributes to virulence in many bacterial pathogens

    • Its highly conserved active site makes development of resistance less likely

    • B. thailandensis serves as a safer model organism for studies relevant to the pathogenic B. pseudomallei

  • High-Throughput Screening Methodology:

    • Develop fluorescence-based enzymatic assays suitable for microplate formats

    • Implement thermal shift assays to identify compounds that bind and stabilize LspA

    • Create cell-based reporter systems in B. thailandensis to identify compounds with cellular activity

    • Design counter-screens to ensure selectivity over human aspartyl proteases

  • Structure-Guided Drug Design Approach:

    • Utilize structural information from related LspA proteins as templates

    • Focus on the catalytic dyad and the 14 highly conserved residues surrounding the active site

    • Target the unique conformational dynamics of the periplasmic helix

    • Consider the multiple binding modes observed with antibiotics like globomycin

  • Existing Antibiotic Templates:

    • Globomycin and myxovirescin provide proven scaffolds for LspA inhibition

    • Neither is commercially viable, but they offer valuable starting points for medicinal chemistry optimization

    • Understanding their binding modes enables rational design of improved inhibitors

The extensive conservation of the LspA active site suggests that resistance mutations would likely interfere with normal enzyme function, making this an especially promising antibiotic target with potential broad-spectrum activity.

What structural features of LspA should be prioritized when designing selective inhibitors?

The design of selective LspA inhibitors should focus on several key structural features:

  • Active Site Architecture:

    • Target the catalytic aspartyl dyad essential for proteolytic activity

    • Exploit the 14 highly conserved residues surrounding the active site

    • Consider the unique environment where the active site interfaces with the membrane

  • Conformational Dynamics:

    • Design inhibitors that capitalize on the natural flexibility of the periplasmic helix

    • Target the intermediate conformational state stabilized by globomycin

    • Consider compounds that can lock the enzyme in non-functional conformations

    • Utilize the understanding that the periplasmic helix fluctuates on the nanosecond timescale

  • Species-Specific Considerations:

    • While core LspA architecture is conserved, subtle species-specific differences may exist

    • Consider the unique lipid environment and membrane composition of Burkholderia species

    • Examine differences between B. thailandensis and pathogenic Burkholderia species to optimize therapeutic potential

  • Methodological Approach for Inhibitor Development:

    • Implement molecular dynamics simulations to predict binding modes and conformational effects

    • Use hybrid experimental approaches combining computational predictions with EPR validation

    • Apply structure-activity relationship studies to optimize lead compounds

    • Consider lipophilicity and membrane permeability in inhibitor design

The β-cradle and periplasmic helix "clamp" mechanism provides a unique structural feature that could be exploited for designing highly specific inhibitors that prevent proper substrate positioning.

What are the promising future research avenues for B. thailandensis LspA studies?

Several high-priority research directions emerge for advancing our understanding of B. thailandensis LspA:

  • Structural Biology:

    • Determine high-resolution structures of B. thailandensis LspA in different states (apo, substrate-bound, inhibitor-bound)

    • Compare with structures from pathogenic Burkholderia species to identify species-specific features

    • Employ cryo-electron microscopy to capture conformational ensembles

  • Systems Biology:

    • Identify the complete lipoprotein substrate profile processed by B. thailandensis LspA

    • Determine the effects of LspA inhibition on the bacterial lipoproteome

    • Investigate regulatory networks controlling LspA expression under different conditions

  • Antibiotic Development:

    • Design novel inhibitors based on structural insights

    • Evaluate efficacy against Burkholderia and other gram-negative pathogens

    • Assess potential for resistance development through directed evolution studies

    • Explore combination therapies targeting multiple steps in lipoprotein processing

  • Pathogenesis Studies:

    • Compare the roles of LspA in B. thailandensis versus pathogenic B. pseudomallei

    • Investigate how LspA-processed lipoproteins contribute to immune evasion

    • Examine potential connections between LspA function and the distinctive LPS structures that contribute to Burkholderia pathogenicity

These research directions promise to advance both fundamental understanding of bacterial lipoprotein processing and therapeutic development against important pathogens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.