Recombinant Burkholderia thailandensis Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction to YidC and Its Role in Bacterial Membranes

YidC is a universally conserved membrane insertase critical for the biogenesis of α-helical membrane proteins. It facilitates the integration, folding, and assembly of membrane proteins either independently or synergistically with the Sec translocon . In Burkholderia thailandensis, YidC plays a role analogous to its homologs in other Gram-negative bacteria, contributing to membrane protein insertion and lipid organization. Recombinant YidC refers to the protein produced via heterologous expression systems (e.g., E. coli) for structural and functional studies .

Recombinant Production

Recombinant Burkholderia YidC is typically expressed as a full-length protein with affinity tags (e.g., His-tag) in E. coli. Key properties include:

PropertyDetails
SpeciesBurkholderia multivorans (homolog of B. thailandensis YidC)
Expression HostE. coli
TagN-terminal His-tag
Molecular Weight~60 kDa (predicted for B. thailandensis)
Amino Acid Sequence553 residues, including a rhodanese-like domain and conserved TM helices
Purity>90% (SDS-PAGE verified)

Substrate Insertion Mechanism

  • Sec-independent insertion: YidC alone mediates integration of small membrane proteins (e.g., Pf3 coat protein) via its hydrophilic groove .

  • Cooperation with Sec translocon: Assists in folding polytopic proteins (e.g., MelB permease) .

  • Lipid scramblase activity: Regulates membrane lipid distribution, impacting bilayer organization .

Interaction Partners

  • YibN: Enhances YidC-mediated insertion of substrates (e.g., F0c, SecG) in E. coli .

  • SecDF-YajC: Genetic linkage suggests functional coordination in membrane protein biogenesis .

Key Studies on YidC

StudyFindingsSource
BioID Proximity LabelingIdentified YibN as a critical YidC interactor in E. coli membranes.
Cryo-EM Structural ModelResolved YidC-ribosome complex, highlighting substrate docking mechanisms.
In Vitro ReconstitutionDemonstrated YidC’s sufficiency for Pf3 coat protein insertion in liposomes.

Implications for B. thailandensis

  • Phase variation: YidC is encoded within a 208.6 kb genomic region prone to RecA-mediated duplication, potentially influencing phenotypic heterogeneity .

  • Antibiotic tolerance: Biofilm-associated YidC may contribute to membrane stability under stress, though direct evidence is lacking .

Challenges and Future Directions

  • Non-essentiality: yidC knockouts in E. coli show no growth defects, complicating functional studies .

  • Structural gaps: No high-resolution structure exists for B. thailandensis YidC, necessitating homology-based modeling.

  • Therapeutic potential: Targeting YidC could disrupt membrane biogenesis in pathogenic Burkholderia species .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If a specific tag type is required, please inform us, and we will prioritize its inclusion.
Synonyms
yidC; BTH_I3235; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-557
Protein Length
full length protein
Species
Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264)
Target Names
yidC
Target Protein Sequence
MDIKRTVLWVIFFMSAVMLFDNWQRSHGRPSMFFPNVTQTNTASNATNGNGASGASAAAA NALPAAATGAAPATTAPAAQAQLVRFSTDVYNGEIDTRGGTLAKLTLTKAGDGKQPDLSV TLFDNAANHTYLARTGLLGGDFPNHNDVYTQAAGPTSLAAGQNTLKLAFESPVKGGVKVV KTYTFTRGSYVIGVDTKIENVGTAPVTPSVYMELVRDNTSVETPMFSHTFLGPAVYTDQK HFQKITFSDIDKNKADYVTSADNGWIAMVQHYFASAWIPQQGAKRDIYVEKIDPTLYRVG VKQPVAAIAPGQSADVSARLFAGPEEERMLEGIAPGLELVKDYGWVTIIAKPLFWLLEKI HGFVGNWGWAIVLLTLLIKAVFFPLSAASYKSMARMKEITPRMQALRERFKSDPQKMNAA LMELYKTEKVNPFGGCLPVVIQIPVFISLYWVLLASVEMRGAPWILWIHDLSQRDPYFIL PVLMAVSMFVQTKLNPTPPDPVQAKMMMFMPIAFSVMFFFFPAGLVLYYVVNNVLSIAQQ YYITRTLGAAAAKKKAS
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the cell membrane. Involved in the integration of membrane proteins, both those dependent and independent of the Sec translocase complex, as well as certain lipoproteins. Facilitates the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Burkholderia thailandensis and why is it important as a source for YidC studies?

Burkholderia thailandensis is a gram-negative bacterium naturally found in soil and water environments, primarily in Southeast Asia and tropical northern Australia, with emerging evidence of presence in the United States . It is the closest known relative to Burkholderia pseudomallei, the causative agent of melioidosis . This close evolutionary relationship makes B. thailandensis an ideal model organism for studying bacterial membrane proteins like YidC for several reasons:

  • Unlike B. pseudomallei which requires biosafety level 3 containment, B. thailandensis can be studied under standard laboratory conditions as it rarely causes serious infections in humans .

  • The genetic similarity between these species means that findings about membrane protein function in B. thailandensis can provide insights into homologous proteins in pathogenic Burkholderia species.

  • B. thailandensis has diverse genotypes that have been identified across different geographical regions, providing valuable comparative study opportunities .

The study of YidC from B. thailandensis offers researchers a safer alternative to working with pathogenic species while still yielding relevant information about bacterial membrane protein insertion mechanisms.

What are the core functions of YidC in bacterial membranes?

YidC is a prominent member of the Oxa1 superfamily that plays essential roles in bacterial inner membrane biogenesis through multiple functions:

  • Protein Insertion: YidC functions as an insertase for small membrane proteins, particularly single-spanning and small multi-spanning membrane proteins .

  • Sec Translocon Cooperation: It interacts with the Sec translocon to facilitate proper folding of complex multi-pass membrane proteins during their insertion process .

  • Lipid Organization: YidC contributes significantly to the organization of the bilayer structure through its lipid scramblase activity .

  • Independent Function: While it can cooperate with the Sec pathway, YidC also operates independently to insert specific subsets of membrane proteins .

These functions collectively make YidC crucial for maintaining bacterial membrane integrity and composition. Experimental evidence demonstrates that YidC directly facilitates the insertion of substrates like phage coat proteins (Pf3 and M13), ATP synthase subunit c, and various small membrane proteins including SecG .

What are the most effective methods for expressing and purifying recombinant B. thailandensis YidC?

Successful expression and purification of recombinant B. thailandensis YidC requires careful optimization of several parameters:

Expression System Selection:

  • E. coli-based systems: BL21(DE3) or C41(DE3) strains are particularly effective for membrane protein expression, with the latter specifically engineered for toxic membrane proteins.

  • Expression vectors: pET series vectors with T7 promoters provide controlled induction using IPTG.

  • Fusion tags: C-terminal His6 tags facilitate purification while minimally impacting function.

Optimized Expression Protocol:

  • Culture cells at lower temperatures (16-20°C) after induction to reduce inclusion body formation

  • Use low inducer concentrations (0.1-0.3 mM IPTG) to promote proper folding

  • Supplement media with specific components that enhance membrane protein expression:

    • 0.5-1% glucose to suppress leaky expression

    • 1 mM betaine as a chemical chaperone

    • Trace metal solutions to support cofactor incorporation

Purification Strategy:

  • Membrane fraction isolation using differential centrifugation

  • Solubilization using mild detergents (n-dodecyl-β-D-maltoside or digitonin at 1-2%)

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Size exclusion chromatography for further purification and buffer exchange

The choice of detergent is particularly critical for maintaining YidC structural integrity and functional activity during purification and subsequent assays. Yield optimization typically requires testing multiple expression conditions in parallel.

How can researchers verify the functional activity of purified recombinant YidC?

Functional verification of recombinant B. thailandensis YidC can be achieved through multiple complementary approaches:

In vitro Translation/Insertion Assays:

  • Prepare inverted membrane vesicles (INVs) containing the recombinant YidC

  • Conduct cell-free translation of known YidC substrates (e.g., Pf3 coat protein, M13 procoat, ATP synthase subunit c, or SecG)

  • Evaluate insertion efficiency through proteinase K protection assays

  • Compare insertion rates with control INVs lacking the recombinant protein

Complementation Studies:

  • Express recombinant YidC in YidC-depleted bacterial strains

  • Assess rescue of growth defects associated with YidC depletion

  • Measure restoration of membrane protein insertion for known YidC-dependent substrates

Binding Assays with Interaction Partners:

  • Conduct affinity purification-mass spectrometry (AP-MS) assays using the recombinant YidC

  • Perform on-gel binding assays with purified YidC and potential interaction partners like YibN

  • Verify interactions through co-immunoprecipitation experiments

A robust functional verification should demonstrate at least 1.5-1.8 fold stimulation of substrate insertion in comparison to control membranes, as observed with YidC interactor proteins like YibN .

How does YibN influence the function of YidC in B. thailandensis?

YibN has been identified as a crucial physical and functional interactor of YidC, significantly enhancing its insertase activity. The relationship between these proteins has been characterized through multiple experimental approaches:

Demonstrated Interactions:

  • Proximity-dependent biotin labeling (BioID) identified YibN within the YidC protein environment

  • Affinity purification-mass spectrometry confirmed the association between YidC and YibN in native membranes

  • On-gel binding assays with purified proteins further validated this interaction

Functional Impact of YibN on YidC Activity:

YidC SubstrateInsertion Enhancement with YibNExperimental Method
Pf3 coat protein1.5-1.8 fold increaseIn vitro translation with YibN-enriched INVs
M13 procoat H51.5-1.8 fold increaseIn vitro translation with YibN-enriched INVs
ATP synthase subunit c (F0c)1.5-1.8 fold increaseIn vitro translation with YibN-enriched INVs
SecG (normal orientation)Significant increase in MPF1 & MPF2Proteinase K protection assay
SecG (inverted orientation)Significant increaseProteinase K protection assay
SecG I20E mutantMinimal enhancementProteinase K protection assay

Additional YibN Effects:

  • Stimulates membrane lipid production

  • Promotes inner membrane proliferation

  • May interfere with YidC lipid scramblase activity

These findings demonstrate that YibN serves as a significant modulator of YidC function, potentially acting as an auxiliary factor that optimizes membrane protein insertion under specific conditions.

What is known about the interaction network of YidC in bacterial membranes?

YidC functions within a complex interaction network in bacterial membranes, coordinating with multiple protein complexes:

1. Sec Translocon Interactions:

  • Associates with SecYEG complex during co-translational insertion of complex membrane proteins

  • May interact with SecA to facilitate post-translational insertion of specific substrates

  • Forms a supercomplex known as the holo-translocon (HTL) that includes SecYEG, SecDF-YajC, and YidC

2. Ribosome Interactions:

  • Directly contacts translating ribosomes at specific binding sites

  • Facilitates co-translational insertion through ribosome nascent chain interactions

  • C-terminal domain of YidC contains positively charged residues that interact with ribosomes

3. Substrate-Specific Interactions:

  • Recognizes hydrophobic transmembrane segments of inserting proteins

  • Accommodates small membrane proteins like Pf3 coat, M13 procoat, and ATP synthase subunit c

  • Provides a protective hydrophobic environment during membrane insertion

4. Newly Identified Interactions:

  • YibN enhances insertion activity and affects lipid organization

  • May interact with components of contact-dependent inhibition systems as suggested by regulatory patterns in Burkholderia species

Understanding this interaction network is crucial for developing complete models of membrane protein biogenesis and provides potential targets for antimicrobial development against pathogenic Burkholderia species.

How do structural differences between B. thailandensis YidC and other bacterial YidC homologs impact function?

The structural and functional comparisons between B. thailandensis YidC and homologs from other bacterial species reveal important evolutionary adaptations that influence insertion activity:

Structural Variations:

  • Transmembrane Domains: While the core 5-TM structure is conserved, B. thailandensis YidC contains subtle variations in the positioning of conserved hydrophilic residues within TM3 and TM5 that form the hydrophilic groove crucial for substrate insertion.

  • Periplasmic Domain: B. thailandensis YidC exhibits a larger periplasmic domain between TM1 and TM2 compared to E. coli YidC, potentially allowing additional interactions with extracytoplasmic regions of substrates.

  • C-terminal Domain: Variations in the positively charged cytoplasmic C-terminal domain may affect interactions with ribosomes and other cytoplasmic factors.

Functional Implications:

  • Altered substrate specificity due to modifications in the hydrophilic groove

  • Different interaction strengths with accessory factors like YibN

  • Potentially unique lipid scramblase activity patterns

These structural differences appear to have evolved to optimize YidC function within the specific membrane composition of B. thailandensis, which differs from other bacteria in phospholipid content and membrane organization. Furthermore, the structural adaptations may contribute to the ability of B. thailandensis to thrive in diverse environmental conditions, from soil to occasional host infection.

What are the implications of YidC's dual role as both an insertase and lipid scramblase in B. thailandensis membrane homeostasis?

The dual functionality of YidC as both a protein insertase and lipid scramblase has profound implications for B. thailandensis membrane homeostasis:

Coordination of Protein and Lipid Dynamics:

  • YidC-mediated protein insertion can be synchronized with lipid rearrangement, ensuring optimal local membrane environment for newly inserted proteins

  • The scramblase activity may help establish asymmetric distribution of specific phospholipids between membrane leaflets

  • This dual activity allows for simultaneous modification of both protein and lipid components during membrane stress responses

Regulatory Mechanisms:

  • YibN has been shown to stimulate membrane lipid production and promote inner membrane proliferation, possibly by interfering with YidC lipid scramblase activity

  • This suggests a sophisticated regulatory network where protein cofactors can modulate the balance between YidC's insertase and scramblase functions

Environmental Adaptation:

  • The dual functionality of YidC may contribute to B. thailandensis' remarkable ability to adapt to diverse environmental conditions

  • Allows rapid membrane remodeling in response to changes in temperature, pH, or nutrient availability

  • May play a role in establishing distinct membrane domains required for specialized functions like contact-dependent inhibition systems

The integration of these two seemingly distinct functions in a single protein represents an elegant solution for coordinating the complex process of membrane biogenesis and remodeling in response to environmental challenges.

What are the key considerations when designing in vitro assays to study B. thailandensis YidC insertion activity?

Designing robust in vitro assays for B. thailandensis YidC requires careful attention to multiple factors:

Preparation of High-Quality Membrane Components:

  • Inverted Membrane Vesicle (INV) Generation:

    • Use gentle physical disruption methods (French press at controlled pressure) to maintain membrane integrity

    • Ensure proper orientation through sucrose gradient purification

    • Verify INV quality through electron microscopy and marker enzyme assays

  • Membrane Composition Considerations:

    • Account for the natural phospholipid composition of B. thailandensis membranes

    • Consider supplementing with specific lipids if using heterologous expression systems

    • Monitor lipid:protein ratios as they significantly impact insertion efficiency

Substrate Selection and Preparation:

  • Use well-characterized YidC substrates as positive controls:

    • Pf3 coat protein

    • M13 procoat H5

    • ATP synthase subunit c (F0c)

    • SecG and variants like SecG I20E

  • Control experiments should include:

    • YidC-depleted membranes

    • YidC-enriched membranes

    • YibN-enriched membranes for comparison

Detection Methods Optimization:

  • Proteinase K Protection Assays:

    • Optimization of proteinase K concentration (typically 0.5-1 mg/ml)

    • Careful timing of digestion (15-30 minutes at room temperature)

    • Use of appropriate controls to distinguish membrane-protected fragments

  • Quantitation Approaches:

    • Radiolabeling with 35S-methionine for highest sensitivity

    • Fluorescent labeling alternatives for safer handling

    • Western blotting with substrate-specific antibodies

    • Quantitative mass spectrometry for complex mixture analysis

Critical Control Parameters:

  • Temperature (maintain 25-30°C for optimal activity)

  • pH (typically 7.0-7.5 for maximal insertion)

  • Salt concentration (100-150 mM KCl or NaCl)

  • Energy source (ATP at 2-5 mM with regenerating system)

  • Reducing environment (1-5 mM DTT or 2-mercaptoethanol)

Carefully optimizing these parameters is essential for obtaining reproducible and physiologically relevant results in YidC insertion assays.

How can researchers address challenges in differentiating between the activities of YidC and other insertion pathways?

Differentiating YidC-specific insertion from other pathways presents several technical challenges. The following methodological approaches help isolate YidC-mediated activities:

Genetic and Biochemical Isolation Strategies:

  • Conditional Depletion Systems:

    • Establish arabinose-controlled YidC expression systems

    • Generate temperature-sensitive YidC variants

    • Use CRISPR interference (CRISPRi) for targeted YidC repression

  • Selective Inhibition:

    • Apply SecA inhibitors (sodium azide at 2-5 mM) to block Sec-dependent pathways

    • Use specific antibodies against YidC to selectively inhibit its function

    • Engineer substrate variants with mutations in Sec-dependent signal sequences

Analysis of Pathway-Specific Substrates:

Insertion PathwayModel SubstratesDistinctive Features
YidC-onlyPf3 coat protein, F0cNo cleavable signal sequence, shorter TM segments
SecYEG-dependentOmpA, PhoECleavable signal sequence, post-translational insertion
SecYEG-YidC cooperativeLacY, MalFMultiple TM segments, complex topology

Advanced Analytical Approaches:

  • Time-resolved Insertion Assays:

    • Follow insertion kinetics to distinguish rapid YidC-mediated vs. slower Sec-dependent insertion

    • Use synchronized translation systems to monitor insertion events in real-time

  • Crosslinking Studies:

    • Apply site-specific crosslinkers to capture YidC-substrate interactions

    • Identify interaction partners through mass spectrometry analysis of crosslinked products

    • Compare crosslinking patterns in wild-type vs. pathway-depleted systems

  • Reconstitution with Purified Components:

    • Establish minimal systems with purified YidC in proteoliposomes

    • Progressively add components of other pathways to assess contribution

    • Measure insertion efficiency with defined component concentrations

By systematically applying these approaches, researchers can effectively distinguish YidC-specific activities from those mediated by other insertion pathways, providing clearer insights into the unique contributions of YidC to membrane protein biogenesis in B. thailandensis.

What genomic approaches can reveal new insights about YidC evolution across Burkholderia species?

Comparative genomic analyses offer powerful approaches for understanding YidC evolution across the Burkholderia genus:

Phylogenomic Analysis Strategies:

  • Whole-genome sequencing of diverse Burkholderia isolates from different geographical regions

  • Construction of species trees based on conserved genomic regions to establish evolutionary relationships

  • Focused analysis of YidC gene regions, including:

    • Coding sequence conservation and selection pressure

    • Regulatory elements and operon structure

    • Horizontal gene transfer signatures

Specific Research Opportunities:

  • Compare YidC sequences across B. thailandensis strains with novel genotypes identified in different regions, such as those found in Sierra Leone

  • Analyze correlation between YidC sequence variations and the distinct phylogenetic clusters observed in B. thailandensis (Asian/Oceanian vs. African strains)

  • Investigate whether quorum sensing systems in B. thailandensis, which regulate numerous genes , impact YidC expression patterns

Methodological Approaches:

  • Next-generation sequencing coupled with advanced bioinformatics pipelines

  • Selection analysis using dN/dS ratios to identify regions under purifying or positive selection

  • Structural modeling to predict functional impacts of sequence variations

  • Transcriptomic analyses across diverse conditions to identify regulatory patterns

These approaches can reveal how YidC has evolved to support the diverse lifestyles of Burkholderia species, from environmental saprophytes to opportunistic and obligate pathogens, potentially identifying critical adaptations that contribute to membrane protein insertion efficiency in different ecological niches.

How might understanding B. thailandensis YidC function contribute to antimicrobial development against pathogenic Burkholderia species?

The essential role of YidC in bacterial membrane biogenesis makes it a promising target for novel antimicrobial strategies against pathogenic Burkholderia species:

Target Validation Considerations:

  • YidC is essential for bacterial viability across diverse species

  • As a membrane protein insertase, it has no direct human homolog with identical function

  • Inhibition would disrupt multiple cellular processes simultaneously, reducing the likelihood of resistance development

  • B. thailandensis serves as an ideal model for testing YidC-targeting compounds against pathogenic Burkholderia, providing a safer alternative to working with B. pseudomallei

Potential Therapeutic Approaches:

StrategyMechanismResearch Status
Small molecule inhibitorsDisruption of YidC insertase active siteEarly-stage screening
Peptide-based inhibitorsCompetitive binding to YidC substrate grooveProof-of-concept studies
YidC-YibN interaction disruptorsPrevention of functional enhancement by YibNTarget validation phase
Destabilizing agentsPromotion of YidC misfolding or degradationConceptual development

Translational Research Pathway:

  • Develop high-throughput screening assays using recombinant B. thailandensis YidC

  • Identify compounds that selectively inhibit YidC without affecting human cellular functions

  • Test efficacy in cellular models using B. thailandensis before progressing to pathogenic species

  • Evaluate resistance development through long-term evolution experiments

  • Address delivery challenges for targeting intracellular bacteria in host cells

This research direction holds particular promise for addressing the intrinsic antibiotic resistance of many Burkholderia species, potentially providing new options for treating melioidosis caused by B. pseudomallei, an important neglected tropical disease with high mortality rates .

What are the most significant unanswered questions regarding B. thailandensis YidC function and regulation?

Despite recent advances in understanding YidC biology, several critical questions remain unanswered:

  • Structural Determinants of Function:

    • What specific structural features distinguish B. thailandensis YidC from homologs in other bacteria?

    • How do these structural differences impact substrate selectivity and insertion mechanisms?

    • What is the precise atomic structure of B. thailandensis YidC in different functional states?

  • Regulatory Networks:

    • How is YidC expression regulated in response to environmental stresses?

    • Does the complex quorum sensing system in B. thailandensis influence YidC activity or expression ?

    • What factors determine the balance between YidC's insertase and lipid scramblase functions?

  • Ecological Relevance:

    • How does YidC function contribute to B. thailandensis survival in diverse environments?

    • Does YidC play a role in the reduced virulence of B. thailandensis compared to B. pseudomallei?

    • How does YidC activity relate to the novel genotypes of B. thailandensis identified in different geographical regions ?

  • YibN Interaction Dynamics:

    • What is the molecular mechanism by which YibN enhances YidC insertion activity ?

    • Is the YidC-YibN interaction conserved across Burkholderia species?

    • Could targeting this interaction provide species-specific antimicrobial approaches?

Addressing these questions will require interdisciplinary approaches combining structural biology, genetics, biochemistry, and systems biology to fully elucidate the complex functions of this essential membrane protein.

What methodological advances are needed to accelerate research on B. thailandensis membrane protein insertion systems?

Several technological and methodological advancements would significantly enhance research on B. thailandensis membrane protein insertion systems:

1. Advanced Imaging Technologies:

  • Cryo-electron microscopy techniques for visualizing transient YidC-substrate complexes

  • Super-resolution microscopy approaches for tracking YidC dynamics in living cells

  • Atomic force microscopy for studying YidC topography in native membranes

2. High-Throughput Functional Assays:

  • Development of reporter systems for monitoring YidC activity in real-time

  • Microfluidic platforms for parallel testing of insertion conditions

  • Biosensor designs that couple substrate insertion to detectable signals

3. Genetic Tool Enhancement:

  • Refinement of CRISPR-Cas9 systems optimized for Burkholderia species

  • Development of tightly regulated inducible promoters specific to B. thailandensis

  • Creation of comprehensive insertion mutant libraries covering membrane protein biogenesis pathways

4. Computational Approaches:

  • Improved algorithms for predicting membrane protein topology and YidC dependence

  • Molecular dynamics simulations of insertion processes in realistic membrane environments

  • Systems biology models integrating transcriptomic, proteomic, and metabolomic data

5. Native Membrane System Advances:

  • Methods for isolating native membrane vesicles while preserving protein complexes

  • Techniques for reconstituting complex insertion machineries in defined proteoliposomes

  • Approaches for studying insertion in membranes with native lipid compositions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.