Recombinant Burkholderia thailandensis NADH-quinone oxidoreductase subunit A (nuoA)

What is NADH-quinone oxidoreductase subunit A (nuoA) and what is its function in Burkholderia thailandensis?

NADH-quinone oxidoreductase subunit A (nuoA) is a component of the bacterial respiratory chain Complex I (NADH dehydrogenase). In Burkholderia thailandensis, nuoA (UniProt accession: Q2SZN5) functions as part of the membrane-embedded subunit of this complex, which catalyzes the transfer of electrons from NADH to quinones in the respiratory chain with EC number 1.6.99.5. This protein plays a critical role in energy production through the creation of a proton gradient across the membrane, which drives ATP synthesis. The nuoA subunit specifically contributes to the structural integrity of Complex I and participates in proton translocation across the bacterial membrane .

What is the molecular structure and key characteristics of Burkholderia thailandensis nuoA?

Burkholderia thailandensis nuoA is a relatively small protein consisting of 119 amino acids. Its amino acid sequence (MNLAAYYPVLLFLLVGTGLGIALVSIGKILGPNKPDSEKNAPYECGFEAFEDARMKFDVRYYLVAILFIIFDLETAFLFPWGVALREIGWPGFIAMMIFLLEFLLGFAYIWKKGGLDWE) reveals a predominantly hydrophobic profile consistent with its membrane-embedded nature. The protein contains transmembrane helices forming its characteristic structure. When expressed as a recombinant protein, nuoA is typically stored in Tris-based buffer with 50% glycerol to maintain stability. The protein is sensitive to repeated freeze-thaw cycles and is optimally stored at -20°C to -80°C for extended periods, with working aliquots maintained at 4°C for up to one week .

How does Burkholderia thailandensis NADH-quinone oxidoreductase compare to similar proteins in other bacterial species?

NADH-quinone oxidoreductase is highly conserved across bacterial species, with nuoA showing structural and functional homology across various gram-negative bacteria. While the core function remains similar, sequence variations exist that reflect evolutionary adaptations to different ecological niches. When compared to other Burkholderia species, such as those in the Burkholderia cepacia complex (BCC) and the plant-beneficial-environmental (PBE) clade, nuoA maintains conserved domains essential for electron transport while displaying species-specific variations .

In comparative studies, Burkholderia thailandensis (strain E264/ATCC 700388/DSM 13276/CIP 106301) nuoA shows distinctive characteristics compared to pathogenic Burkholderia species like B. pseudomallei and B. mallei, making it valuable for studying functional differences that might relate to pathogenicity without the biosafety concerns of working with more hazardous species. Unlike some other bacterial species, Burkholderia thailandensis can modulate respiratory components including nuoA expression during biofilm formation and under different oxygen conditions .

What methodological approaches are most effective for expressing and purifying recombinant Burkholderia thailandensis nuoA?

The expression and purification of membrane proteins like nuoA present significant challenges due to their hydrophobic nature. Based on current research protocols, the most effective expression system utilizes E. coli strains optimized for membrane protein expression, such as C41(DE3) or C43(DE3). Expression vectors containing a strong inducible promoter (T7 or tac) coupled with fusion tags (His6, MBP, or SUMO) enhance both expression and downstream purification efficiency.

The optimized purification protocol involves:

• Cell lysis under mild conditions (typically using lysozyme combined with gentle detergent solubilization)

• Membrane fraction isolation via differential centrifugation

• Solubilization using appropriate detergents (DDM, LMNG, or C12E8)

• Affinity chromatography utilizing the fusion tag

• Size exclusion chromatography for final purification

Critical factors affecting yield and purity include:

For structural studies, researchers should consider detergent exchange to amphipols or reconstitution into nanodiscs during the final purification steps to enhance stability .

How can researchers effectively investigate the role of nuoA in Burkholderia virulence and host interaction?

Investigating nuoA's role in Burkholderia virulence requires a multi-faceted approach combining genetic manipulation, host-pathogen interaction models, and metabolic analysis. The preferred methodology employs:

• Genetic manipulation: Creating nuoA deletion mutants (ΔnuoA) through allelic exchange, complementation strains, and point mutations in conserved residues. CRISPR-Cas9 systems adapted for Burkholderia can achieve precise genome editing.

• Phenotypic characterization: Assessing growth kinetics under varied oxygen concentrations, biofilm formation capacity, and cellular respiration rates using oxygen consumption assays and membrane potential measurements.

• Host interaction models: Utilizing plant models such as sugarcane root colonization assays to examine:

  • Biofilm formation at root surfaces

  • Bacterial persistence in planta

  • Plant immune response markers

  • Changes in plant gene expression through dual RNA-seq

Research by various groups indicates that during plant-bacterial interactions, Burkholderia species modify respiratory chain components to adapt to the microaerobic environment of plant tissues. Specifically, nuoA and other respiratory complex components are upregulated when Burkholderia forms biofilms on plant roots, suggesting their importance in host colonization .

Table: Differential expression of respiratory components during plant colonization

These expression changes coincide with the bacteria's ability to suppress virulence factors that would typically trigger plant immune responses, suggesting a complex regulatory network involving energy metabolism and virulence .

What are the technical challenges in studying protein-protein interactions involving nuoA in the respiratory complex?

Studying protein-protein interactions involving nuoA presents several technical challenges due to its membrane-embedded nature and its participation in the multi-subunit NADH-quinone oxidoreductase complex. Researchers face the following key challenges and methodological solutions:

• Maintaining native membrane protein interactions: The hydrophobic environment of the membrane is difficult to replicate in vitro. Solutions include:

  • Nanodisc technology incorporating native-like lipid bilayers

  • Styrene-maleic acid lipid particles (SMALPs) that preserve the native lipid environment

  • Detergent screening to identify conditions that maintain protein-protein interactions

• Distinguishing direct from indirect interactions: In a complex with multiple subunits, determining direct interaction partners requires:

  • Cross-linking mass spectrometry (XL-MS) with membrane-permeable crosslinkers

  • Förster resonance energy transfer (FRET) using specifically labeled subunits

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction interfaces

• Reconstituting functional complexes: Demonstrating that observed interactions are functionally relevant requires:

  • Activity assays that measure electron transfer using artificial electron acceptors

  • Membrane potential measurements using fluorescent probes

  • Proton pumping assays to assess functional integrity

The most successful approaches combine multiple complementary techniques, such as blue native PAGE to isolate intact complexes, followed by chemical crosslinking and mass spectrometry to map specific interaction sites.

What are the optimal conditions for enzymatic activity assays of recombinant nuoA?

• Reconstitution assays: Combining purified nuoA with other subunits of the complex to restore partial or complete activity

• NADH oxidation assay conditions:

• Membrane potential monitoring: Using fluorescent dyes like Rhodamine 123 or DiSC3(5) to measure the generation of membrane potential in proteoliposomes containing reconstituted complexes with nuoA

• Inhibitor studies: Employing specific Complex I inhibitors such as rotenone or piericidin A to validate that the observed activity is indeed from the NADH-quinone oxidoreductase complex

Activity measurements should be normalized to protein concentration, and multiple technical and biological replicates should be performed to ensure reproducibility. Control experiments using preparations lacking nuoA are essential to demonstrate its specific contribution to the observed activity .

How can researchers effectively identify and characterize nuoA post-translational modifications?

Post-translational modifications (PTMs) of nuoA can significantly impact its function, localization, and interactions within the respiratory complex. A comprehensive approach to identifying and characterizing nuoA PTMs includes:

• Mass spectrometry-based approaches:

  • Bottom-up proteomics: Digestion of nuoA with multiple proteases followed by LC-MS/MS analysis

  • Top-down proteomics: Analysis of intact nuoA to preserve all modifications

  • Targeted MS methods: Multiple reaction monitoring (MRM) for specific modifications

• Enrichment strategies for specific PTMs:

  • Phosphorylation: Titanium dioxide or immobilized metal affinity chromatography

  • Glycosylation: Lectin affinity chromatography

  • Ubiquitination/SUMOylation: Antibody-based enrichment

• Site-directed mutagenesis to validate functional significance:

  • Mutation of identified PTM sites to non-modifiable residues

  • Creation of phosphomimetic mutations (e.g., Ser to Asp for phosphorylation)

  • Functional assays comparing wild-type and mutant proteins

• Temporal dynamics of PTMs:

  • Pulse-chase experiments combined with MS analysis

  • Time-course studies under different environmental conditions

For nuoA specifically, researchers should focus on monitoring phosphorylation and acetylation sites, as these have been shown to regulate bacterial respiratory complex activity in other systems. Special attention should be paid to conserved residues in transmembrane regions and interface regions between subunits.

What bioinformatic tools and databases are most useful for analyzing nuoA sequence, structure, and function?

Researchers studying nuoA can leverage a range of bioinformatic tools and databases for comprehensive analysis:

• Sequence Analysis Tools:

  • UniProt (Q2SZN5): Primary source for curated protein information

  • BLAST/PSI-BLAST: Identification of homologs across species

  • Clustal Omega/MUSCLE: Multiple sequence alignment to identify conserved regions

  • HMMER: Profile-based sequence searches for distant homologs

• Structural Prediction and Analysis:

  • AlphaFold2/RoseTTAFold: State-of-the-art protein structure prediction

  • SWISS-MODEL: Homology modeling using known structures as templates

  • TMHMM/TOPCONS: Transmembrane helix prediction

  • ConSurf: Mapping conservation onto structural models

• Functional Analysis:

  • InterPro/Pfam: Domain and functional site prediction

  • STRING: Protein-protein interaction network analysis

  • KEGG/BioCyc: Metabolic pathway analysis

  • Gene Ontology (GO): Functional classification

• Specialized Resources for Respiratory Complexes:

  • Complex I database (https://www.complexi.org/): Dedicated resource for NADH:ubiquinone oxidoreductase

  • Bacterial Respiratory Chain Complexes Database (BRCD): Information on bacterial energy metabolism components

Workflow recommendation for nuoA analysis:

• Begin with UniProt for basic sequence information and known features

• Perform evolutionary analysis using multiple sequence alignments of nuoA across Burkholderia species

• Generate structural models with AlphaFold2, focusing on membrane topology

• Analyze conservation patterns and map them onto the structural model

• Identify potential functional sites based on conservation and structural features

• Predict protein-protein interactions within the Complex I assembly

This systematic approach provides a robust foundation for experimental design and interpretation of results related to nuoA structure and function.

How does nuoA expression vary under different environmental conditions in Burkholderia thailandensis?

Burkholderia thailandensis modulates nuoA expression in response to environmental cues, particularly oxygen availability and carbon source. Research indicates several key patterns:

• Oxygen-dependent regulation:

  • Under aerobic conditions, nuoA expression maintains baseline levels

  • In microaerobic environments (such as plant root tissues), nuoA expression increases significantly

  • During transition to anaerobic conditions, a transient upregulation occurs before adaptation to alternative respiratory pathways

• Carbon source influence:

  • Complex carbon sources induce higher nuoA expression compared to simple sugars

  • Oxalate as a carbon source particularly enhances expression of respiratory components including nuoA

  • C4-dicarboxylates (malate, succinate) present in plant root exudates stimulate nuoA expression

• Biofilm vs. planktonic states:

  • Biofilm formation, particularly at plant root surfaces, correlates with increased expression of bd-type cytochromes and nuoA

  • This upregulation creates microaerobic conditions suitable for bacterial nitrogen fixation and plant-beneficial interactions

Table: nuoA expression profiles under different environmental conditions

These expression patterns highlight nuoA's importance in Burkholderia's adaptation to diverse ecological niches, particularly in establishing beneficial relationships with plants. The upregulation during plant root colonization suggests that energy metabolism through Complex I plays a crucial role in successful host interaction .

What role does nuoA play in Burkholderia biofilm formation and plant interaction?

Burkholderia thailandensis nuoA serves critical functions during biofilm formation and plant interaction that extend beyond its primary role in energy metabolism:

• Biofilm establishment and maintenance:

  • nuoA upregulation contributes to the bioenergetic requirements of initial surface attachment

  • The protein helps maintain proton motive force necessary for biofilm matrix production

  • Metabolic shifts involving nuoA and other respiratory components create microniches within the biofilm structure

• Plant-microbe interface dynamics:

  • During root colonization, nuoA participates in creating microaerobic conditions that:

    • Support bacterial nitrogen fixation capabilities

    • Modify local oxygen tension to prevent triggering plant defense responses

    • Enable bacterial persistence in the rhizosphere

• Immunomodulatory effects:

  • The respiratory activity involving nuoA contributes to suppressing typical virulence factors

  • This suppression prevents triggering plant immune responses, allowing for extended colonization

  • Creates conditions for mutually beneficial exchange rather than pathogenic interaction

Research demonstrates that when Burkholderia forms biofilms at plant root surfaces, it increases expression of bd-type cytochromes and nuoA components. This respiratory adaptation enables the bacterium to thrive in the plant rhizosphere while establishing a beneficial relationship. Simultaneously, the plant responds with physiological changes including increased ethylene production and aerenchyma formation, facilitating oxygen diffusion to support the bacterial symbiont .

Electron microscopy studies of Burkholderia biofilms on plant roots reveal distinctive architectural features correlating with respiratory adaptation. The bacteria form microcolonies with specialized respiratory zones, suggesting that nuoA and other respiratory components participate in creating metabolic gradients essential for stable plant-microbe interaction.

How can nuoA be targeted for potential antimicrobial development against Burkholderia species?

NADH-quinone oxidoreductase subunit A (nuoA) represents a promising antimicrobial target due to its essential role in bacterial energy metabolism. Strategies for targeting nuoA include:

• Small molecule inhibitors:

  • Identification of specific binding pockets within nuoA using structural modeling

  • Development of compounds that disrupt nuoA assembly into the larger Complex I

  • Design of molecules that interfere with transmembrane proton translocation

• Peptide-based inhibitors:

  • Design of synthetic peptides mimicking critical interaction interfaces

  • Peptides targeting the nuoA-membrane interface to disrupt proper insertion

  • Cell-penetrating antimicrobial peptides with specificity for nuoA-containing complexes

• Structure-based drug design approach:

• Considerations for specificity:

  • Targeting features unique to Burkholderia that differ from human mitochondrial Complex I

  • Focusing on bacterial-specific transmembrane regions

  • Developing delivery systems that preferentially accumulate in bacterial membranes

While traditional antibiotics target cell wall synthesis, protein synthesis, or DNA replication, targeting energy metabolism through nuoA offers an alternative approach that could be effective against persistent or slow-growing forms of Burkholderia. Importantly, comparative analysis of Burkholderia identification systems reveals that accurate species identification is crucial for developing targeted approaches, as nuoA sequences and structures vary between Burkholderia species such as B. thailandensis, B. gladioli, and B. pickettii .