Recombinant Burkholderia thailandensis NADH-quinone oxidoreductase subunit K (nuoK)

What is Burkholderia thailandensis and why is it significant as a model organism?

Burkholderia thailandensis is a gram-negative, soil-dwelling bacterium closely related to the highly pathogenic B. pseudomallei, the causative agent of melioidosis. Unlike its virulent relatives, B. thailandensis is considered avirulent, making it a valuable surrogate for laboratory research . Multiple novel B. thailandensis sequence types have been identified through multi-locus sequence typing (MLST), revealing significant genetic diversity within this species . Phylogenetic analyses have shown that B. thailandensis strains form distinct clusters, with Asian isolates grouping separately from African isolates, suggesting geographical influence on evolutionary development .

For research purposes, B. thailandensis strain E264 (ATCC 700388) is commonly used as a reference strain due to its well-characterized genome . This strain serves as an excellent model system for understanding the basic biology, metabolism, and protein function of the Burkholderia genus without the biosafety concerns associated with handling pathogenic species. Recent transcriptome-proteome profiling studies have identified 928 differentially expressed genes and 832 differentially expressed proteins during the transition from exponential to stationary growth phases, demonstrating the complex regulatory networks in this organism .

What is the NADH-quinone oxidoreductase complex and what specific role does subunit K play?

NADH-quinone oxidoreductase (EC 1.6.99.5), also known as Complex I or NADH dehydrogenase I, is a multisubunit enzyme complex that forms the first entry point of the electron transport chain in bacterial respiratory systems. This complex catalyzes the transfer of electrons from NADH to quinones while simultaneously pumping protons across the membrane to generate a proton motive force for ATP synthesis .

The B. thailandensis Complex I consists of multiple subunits, including nuoA through nuoN. While detailed information about nuoK is limited, by examining the related nuoA subunit (Q2SZN5), we can infer that nuoK likely plays a critical role in the membrane domain of Complex I . Like nuoA, which spans the membrane with its characteristic hydrophobic segments (MNLAAYYPVLLFLLVGTGLGIALVSIGKILGP), nuoK is expected to contribute to proton translocation and the stability of the membrane domain of the enzyme complex .

The complete Complex I in B. thailandensis functions in cellular energy production, with gene expression profiles showing significant regulation during different growth phases. During stationary phase, bacteria often reconfigure their respiratory complexes as part of adaptive responses to nutrient limitation, which may involve altered expression of nuoK and other respiratory chain components .

How does B. thailandensis NADH-quinone oxidoreductase compare with homologous proteins in related pathogenic species?

The NADH-quinone oxidoreductase complex in B. thailandensis shares high sequence homology with corresponding complexes in pathogenic Burkholderia species, including B. pseudomallei and B. mallei. This homology makes it an excellent model for studying the structure and function of respiratory complexes in pathogenic strains without the associated biosafety risks .

Specific differences between B. thailandensis and B. pseudomallei complexes may contribute to their distinct metabolic capabilities. For example, transcriptome-proteome profiling reveals that B. thailandensis demonstrates unique adaptations in energy metabolism during stationary phase, with distinct patterns of regulation compared to what has been observed in other bacterial species . Unlike typical bacteria where the RpoS sigma factor increases during stationary phase, B. thailandensis shows only modest correlation between transcriptome and proteome changes, suggesting distinct post-translational regulatory mechanisms .

Comparative analysis of respiratory chain components between these species can provide insights into how metabolic adaptations contribute to pathogenicity. Understanding these differences may help identify potential therapeutic targets specific to pathogenic species while using the non-pathogenic B. thailandensis as a research model.

What expression systems are most effective for producing recombinant B. thailandensis nuoK?

For expressing recombinant B. thailandensis nuoK, researchers should consider several expression systems, each with specific advantages for membrane protein production:

E. coli-based systems: The pET vector series with BL21(DE3) or C41(DE3)/C43(DE3) host strains, specifically engineered for membrane protein expression, often provide good yields. For nuoK, which is a hydrophobic membrane protein, expression can be optimized by using lower induction temperatures (16-20°C) and reduced inducer concentrations to prevent the formation of inclusion bodies.

Cell-free expression systems: These can be particularly advantageous for toxic or membrane proteins like nuoK, allowing direct incorporation into artificial membrane systems or nanodiscs during synthesis. While yields may be lower than in vivo systems, the protein quality and native folding can be superior.

The specific expression approach for nuoK should be modeled after successful protocols for other membrane-bound subunits of NADH-quinone oxidoreductase, such as nuoA, which has demonstrated successful expression as seen in commercial preparations . Expression constructs should include affinity tags (His6 or Strep-tag II) positioned to avoid interference with membrane insertion or protein function.

What purification strategies maintain structural integrity of membrane-integrated nuoK?

Purifying membrane proteins like nuoK requires specialized approaches to maintain structural integrity:

Membrane isolation and solubilization: Following cell lysis, membrane fractions should be isolated by ultracentrifugation. The membrane fraction containing nuoK should be solubilized using mild detergents such as n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin, which effectively maintain protein structure while extracting it from the membrane.

Affinity chromatography: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is effective for His-tagged nuoK, with purification buffers containing detergent concentrations above the critical micelle concentration to prevent protein aggregation.

Size exclusion chromatography: A final polishing step using size exclusion chromatography helps remove aggregates and ensure protein homogeneity in the desired oligomeric state.

Throughout purification, protein stability should be monitored using techniques such as dynamic light scattering or differential scanning fluorimetry. Storage conditions similar to those used for nuoA (Tris-based buffer with 50% glycerol at -20°C) may be applicable, though optimization is recommended for nuoK specifically .

How can researchers assess the functional integrity of purified recombinant nuoK?

Assessing functional integrity of purified nuoK involves several complementary approaches:

Structural assessment:

• Circular dichroism (CD) spectroscopy to confirm proper secondary structure

• Thermal stability assays to evaluate protein folding

• Limited proteolysis to assess tertiary structure integrity

Functional assessment:

• Reconstitution into liposomes or nanodiscs to evaluate membrane integration

• NADH oxidation activity measurements when co-reconstituted with other Complex I subunits

• Proton pumping assays using pH-sensitive fluorescent dyes

Protein-protein interaction studies:

• Pull-down assays to verify interactions with other Complex I subunits

• Native PAGE or blue native PAGE to assess complex formation

• Chemical cross-linking followed by mass spectrometry to identify interaction interfaces

For nuoK specifically, functional integrity would typically be evaluated in the context of the assembled Complex I rather than as an isolated subunit, given its role in the membrane domain of the enzyme complex.

What approaches are most effective for determining the structure of membrane-embedded nuoK?

Determining the structure of membrane proteins like nuoK presents unique challenges that require specialized techniques:

Cryo-electron microscopy (cryo-EM): Currently the method of choice for membrane protein complexes, cryo-EM can resolve structures without the need for crystallization. For nuoK, this would typically involve purifying the entire Complex I or a stable subcomplex containing nuoK. Recent advances in single-particle analysis have enabled high-resolution structures of membrane proteins similar to nuoK subunits.

X-ray crystallography: Though challenging for membrane proteins, crystallization in lipidic cubic phases (LCP) or with the use of crystallization chaperones (antibody fragments) can sometimes yield high-resolution structures. For nuoK, detergent screening and lipid supplementation are critical parameters for successful crystallization.

NMR spectroscopy: Solution NMR or solid-state NMR can provide valuable structural information, particularly about dynamics and conformational changes. For small membrane proteins or specific domains of nuoK, selective isotope labeling can enhance signal resolution.

Integrative structural biology: Combining low-resolution techniques (SAXS, SANS) with computational modeling and evolutionary coupling analysis can provide structural insights when high-resolution methods are challenging.

The approach to structural studies should build upon transcriptome-proteome profiling data from B. thailandensis, which provides context for understanding structural changes that may occur during different growth phases or environmental conditions .

How do modern computational methods complement experimental structural studies of nuoK?

Computational methods provide valuable complements to experimental structural studies of nuoK:

Homology modeling: Using structures of homologous proteins from related organisms as templates. While no specific structural data for B. thailandensis nuoK is available in the search results, models can be built based on NADH-quinone oxidoreductase structures from other bacteria.

Molecular dynamics (MD) simulations: Particularly useful for membrane proteins like nuoK, MD simulations can predict protein behavior in lipid bilayers, conformational changes, and functional mechanisms. Coarse-grained simulations can model larger systems for longer timescales.

Protein-protein docking: Computational prediction of how nuoK interacts with other Complex I subunits helps understand assembly and function of the complete complex.

Sequence-based predictions: Tools like AlphaFold2 and RoseTTAFold have revolutionized protein structure prediction, potentially providing accurate structural models of nuoK even without experimental templates.

These computational approaches should incorporate data from the phylogenetic analyses of B. thailandensis strains to account for strain-specific variations that might affect protein structure and function .

What techniques can reveal dynamic conformational changes in nuoK during enzyme function?

Understanding the dynamic behavior of nuoK during catalysis requires specialized techniques:

Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique identifies regions of the protein that undergo conformational changes by measuring solvent accessibility changes. For nuoK, HDX-MS can reveal how different regions respond to substrate binding or during the catalytic cycle.

Site-directed spin labeling with EPR: By introducing spin labels at strategic positions in nuoK, researchers can monitor distance changes between specific residues during protein function.

Single-molecule FRET: When reconstituted into nanodiscs or liposomes, fluorescently labeled nuoK can be studied at the single-molecule level to observe conformational dynamics in real-time.

Time-resolved spectroscopy: Techniques like time-resolved fluorescence or infrared spectroscopy can capture transient conformational states during the reaction cycle.

These approaches can be informed by the transcriptome-proteome profiling data, which suggest unique post-translational regulatory mechanisms in B. thailandensis that may influence protein dynamics .

What role might nuoK play in bacterial adaptation to environmental stress?

The role of nuoK in stress adaptation can be investigated through several approaches:

Differential expression analysis:
While specific data on nuoK expression is not provided in the search results, the transcriptome-proteome profiling of B. thailandensis revealed significant changes in respiratory chain components during transition to stationary phase . Similar analysis focused specifically on nuoK could reveal its regulation during stress conditions.

Stress resistance phenotyping:

• Comparing wild-type and nuoK mutant strains under various stressors (oxidative stress, nutrient limitation, pH changes)

• Measuring survival rates during host cell infection models

• Assessing biofilm formation capacity, which often correlates with stress resistance

Metabolic flux analysis:

• Tracing metabolic pathways under stress conditions in wild-type vs. nuoK-modified strains

• Measuring NAD+/NADH ratios to assess redox balance

• Quantifying ATP production efficiency under different environmental conditions

Research indicates that B. thailandensis employs unique adaptive mechanisms during stationary phase, with only modest correlation between transcriptome and proteome changes, suggesting post-translational regulation that may involve respiratory chain components like nuoK .

How does nuoK interact with other subunits within the Complex I architecture?

Understanding nuoK's interactions within Complex I involves:

Cross-linking coupled with mass spectrometry:

• Chemical cross-linking to capture transient interactions

• Identification of cross-linked peptides by mass spectrometry

• Mapping interaction interfaces between nuoK and neighboring subunits

Co-immunoprecipitation studies:

• Pull-down experiments using tagged nuoK to identify associated proteins

• Reciprocal co-IP experiments with other Complex I subunits

• Analysis of interaction dependencies under different conditions

In situ proximity labeling:

• APEX2 or BioID fusion to nuoK for proximity-dependent biotinylation

• Identification of proteins in close proximity to nuoK within the native cellular environment

• Temporal analysis of interaction changes during different growth phases

These interaction studies should be designed with consideration of the membrane domain architecture, where nuoK likely functions similar to nuoA, which contains hydrophobic segments for membrane integration (MNLAAYYPVLLFLLVGTGLGIALVSIGKILGP) .

How can nuoK research inform our understanding of pathogenic Burkholderia species?

Research on B. thailandensis nuoK provides valuable insights into pathogenic Burkholderia species:

Comparative genomics approach:

• Alignment of nuoK sequences from B. thailandensis, B. pseudomallei, and B. mallei to identify conserved and variable regions

• Analysis of selection pressure on different domains to identify functionally critical regions

• Identification of pathogen-specific adaptations in nuoK structure or regulation

Functional substitution experiments:

• Replacing B. thailandensis nuoK with homologs from pathogenic species

• Assessing impacts on enzyme activity, complex assembly, and cellular physiology

• Identifying specialized functions that may contribute to virulence

Structural comparison:

• Developing structural models of nuoK from both B. thailandensis and pathogenic species

• Identifying structural differences that may correlate with pathogenic adaptations

• Using findings to inform therapeutic targeting of pathogen-specific features

This comparative approach builds on the foundation established by phylogenetic analysis of B. thailandensis strains, which revealed distinct clustering patterns between Asian and African isolates, suggesting evolutionary divergence that may extend to respiratory chain components .

What differences in nuoK might contribute to virulence in pathogenic Burkholderia species?

Potential virulence-related differences in nuoK could be investigated through:

Expression pattern analysis:

• Comparing nuoK expression levels between pathogenic and non-pathogenic species during host infection

• Analyzing regulation of nuoK in response to host defense mechanisms

• Determining if nuoK is differentially regulated in intracellular vs. extracellular environments

Host interaction studies:

• Investigating whether nuoK contributes to survival within host macrophages

• Assessing the impact of nuoK mutations on host immune response

• Determining if nuoK influences bacterial persistence during chronic infection

Metabolic adaptation analysis:

• Comparing energy production efficiency between pathogenic and non-pathogenic species

• Assessing whether nuoK contributes to adaptation to the host metabolic environment

• Identifying potential host-specific metabolic niches where nuoK function is critical

These investigations should consider the unique adaptive mechanisms observed in B. thailandensis, where RpoS (typically abundant during stationary phase in other bacteria) was not significantly increased during early stationary phase, suggesting distinct regulatory systems that may influence virulence potential .

Can nuoK serve as a potential drug target, and how might recombinant protein facilitate such studies?

Exploring nuoK as a drug target involves several strategic approaches:

Target validation studies:

• Assessing essentiality of nuoK in pathogenic Burkholderia under relevant conditions

• Determining whether inhibition of nuoK function compromises bacterial viability

• Evaluating potential for resistance development through compensatory mechanisms

Structure-based drug design:

• Using structural models of B. thailandensis nuoK to identify potential binding pockets

• Virtual screening of compound libraries against identified binding sites

• Rational design of inhibitors targeting conserved functional domains

High-throughput screening approaches:

• Developing activity assays suitable for compound screening

• Creating reporter systems to monitor nuoK function in whole cells

• Establishing counterscreens to ensure specificity for bacterial over human homologs

Recombinant nuoK protein facilitates these studies by providing material for:

• In vitro binding and inhibition assays

• Structural studies to guide inhibitor optimization

• Validation of hits from virtual or high-throughput screens

This approach aligns with the broader research paradigm where B. thailandensis serves as a safe surrogate for studies targeting pathogenic Burkholderia species .

Data Table: Comparison of NADH-quinone oxidoreductase Subunits in B. thailandensis

*Based on general patterns of respiratory chain components in transcriptome-proteome profiling studies

How can researchers address protein aggregation issues when working with recombinant nuoK?

Membrane proteins like nuoK frequently encounter aggregation challenges that can be addressed through:

Optimization of expression conditions:

• Testing induction at lower temperatures (16-18°C)

• Using weaker promoters to slow production rate

• Coexpressing molecular chaperones (GroEL/GroES, DnaK/DnaJ)

Solubilization strategy refinement:

• Screening detergent panels ranging from harsh (SDS) to mild (digitonin)

• Testing mixed micelle systems with lipid supplementation

• Employing amphipols or nanodiscs for detergent-free stabilization

Buffer optimization:

• Implementing high-throughput buffer screening

• Adding stabilizing agents (glycerol, specific ions, osmolytes)

• Adjusting pH and ionic strength based on theoretical isoelectric point

These approaches should be informed by successful protocols for other membrane subunits of NADH-quinone oxidoreductase, such as nuoA, which has been successfully prepared as a recombinant protein .

What strategies can improve the yield of functional recombinant nuoK?

Improving functional yields of nuoK involves several strategic approaches:

Codon optimization:

• Adapting codons to expression host preferences

• Eliminating rare codons that might cause translational pausing

• Adjusting GC content for optimal mRNA stability

Fusion partner selection:

• Testing solubility-enhancing fusion partners (MBP, SUMO, Trx)

• Using fluorescent protein fusions to monitor expression levels

• Incorporating cleavable tags for purification flexibility

Post-expression handling:

• Implementing rapid purification protocols to minimize degradation

• Using protease inhibitors throughout sample processing

• Storing protein in stabilizing conditions similar to those used for nuoA (Tris-based buffer with 50% glycerol at -20°C)

These yield optimization strategies should consider B. thailandensis' distinctive protein expression patterns, particularly the post-translational regulatory mechanisms suggested by transcriptome-proteome correlation studies .

How can researchers validate that recombinant nuoK retains native-like properties?

Validating native-like properties of recombinant nuoK requires multi-faceted assessment:

Structural comparison:

• Secondary structure analysis by circular dichroism compared to predictions

• Thermal stability profiles consistent with membrane proteins

• Correct oligomeric state determination by native PAGE or crosslinking

Functional validation:

• Ability to complement nuoK deletion mutants

• Integration into partial or complete Complex I assemblies

• Contribution to NADH oxidation activity when incorporated into proteoliposomes

Interaction verification:

• Binding to known partner proteins within Complex I

• Correct membrane topology verified by protease accessibility

• Lipid binding preferences consistent with theoretical predictions

These validation approaches should be designed with consideration of the heterogeneity observed in B. thailandensis strains, as different isolates may exhibit variation in protein properties .