Recombinant Burkholderia thailandensis Probable intracellular septation protein A (BTH_I2138)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; BTH_I2138; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264)
Target Names
BTH_I2138
Target Protein Sequence
MKFLFDLFPIILFFAAFKLWGIFTATAVAIAATLAQVAWVAFRHRKVDTMLWVSLGVIVV FGGATLVLHDEKFIQWKPTVLYWLFAVGLVAARYAFGKNLIEKMMGKQLTLPEPVWDKLN LAWAAFFAALGVTNLYVVRNFTESQWVNFKLFGTTGAIIVFVILQSLWLAKYLKGE
Uniprot No.

Target Background

Function
Plays a role in cell envelope biogenesis, maintenance of cell envelope integrity, and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How is Recombinant BTH_I2138 Protein Typically Expressed and Purified?

Recombinant BTH_I2138 is typically expressed in E. coli expression systems following these methodological steps:

  • Cloning and Vector Construction:

    • The BTH_I2138 gene (full-length 1-176 aa) is amplified from B. thailandensis genomic DNA

    • The gene is cloned into an expression vector (commonly pET-28a) with an N-terminal His-tag fusion

    • Sequence verification confirms correct insertion and orientation

  • Expression Conditions:

    • Transformation into E. coli BL21(DE3) strain

    • Culture growth at 37°C to mid-log phase

    • Induction with IPTG (typically 0.5-1.0 mM)

    • Post-induction growth at reduced temperature (16-25°C) for 4-18 hours

  • Purification Protocol:

    • Cell lysis by sonication in a Tris/PBS-based buffer

    • Affinity chromatography using His-Trap columns

    • Elution with imidazole gradient

    • Further purification by size-exclusion chromatography if needed

  • Storage Recommendations:

    • Lyophilization or storage in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

    • Aliquoting with 50% glycerol for long-term storage at -20°C/-80°C

    • Avoiding repeated freeze-thaw cycles, with working aliquots stored at 4°C for up to one week

The typical purity achieved is greater than 90% as determined by SDS-PAGE analysis, making the protein suitable for various research applications.

What is the Structure-Function Relationship of BTH_I2138?

BTH_I2138's structure directly relates to its function in bacterial cell division:

  • Membrane Topology:

    • The protein contains multiple transmembrane domains that anchor it within the inner bacterial membrane

    • Hydrophobic regions form alpha-helical transmembrane segments that span the lipid bilayer

    • Hydrophilic loops connect the transmembrane segments and may interact with cytoplasmic or periplasmic proteins

  • Functional Domains:

    • N-terminal region: Contains membrane-targeting sequences

    • Central region: Likely involved in protein-protein interactions with division machinery

    • C-terminal region: May participate in signaling or regulatory interactions

  • Structural Homology:

    • Similar structural features are found in YciB family proteins across bacterial species

    • Conserved motifs suggest common mechanistic functions in cell division

  • Predicted Role in Cell Division:

    • Localization to the division septum during cell division

    • Coordination with other division proteins to ensure proper septum formation

    • Potential role in recruiting or stabilizing divisome components

While a high-resolution structure has not yet been determined, computational models suggest a multi-pass membrane protein with domains extending into both the cytoplasm and periplasm .

What Methods Can Be Used to Assess BTH_I2138 Expression Levels?

Researchers can employ several complementary techniques to quantify BTH_I2138 expression:

  • Quantitative Real-Time PCR (qRT-PCR):

    • Principle: Measures BTH_I2138 mRNA levels using gene-specific primers

    • Protocol:

      • Extract total RNA from B. thailandensis cultures

      • Synthesize cDNA using reverse transcriptase

      • Perform qPCR with BTH_I2138-specific primers

      • Normalize to housekeeping genes (e.g., 16S rRNA)

    • Advantages: High sensitivity, quantitative, relatively simple

    • Limitations: Measures transcript but not protein levels

  • Western Blot Analysis:

    • Principle: Detects BTH_I2138 protein using specific antibodies

    • Protocol:

      • Prepare bacterial lysates from various growth conditions

      • Separate proteins by SDS-PAGE

      • Transfer to membrane and probe with anti-BTH_I2138 antibodies

      • Use isocitrate dehydrogenase (ICDH) as loading control

    • Advantages: Directly measures protein levels, can detect post-translational modifications

    • Limitations: Requires specific antibodies, semi-quantitative

  • Reporter Gene Fusions:

    • Principle: BTH_I2138 promoter drives expression of a reporter gene (GFP, luciferase)

    • Protocol:

      • Clone BTH_I2138 promoter upstream of reporter gene

      • Integrate construct into B. thailandensis genome

      • Measure reporter activity under various conditions

    • Advantages: Real-time monitoring, in vivo analysis

    • Limitations: Measures transcriptional activity, not protein levels

  • Mass Spectrometry-Based Proteomics:

    • Principle: Direct identification and quantification of BTH_I2138 peptides

    • Protocol:

      • Extract proteins from B. thailandensis

      • Digest with trypsin and analyze by LC-MS/MS

      • Quantify BTH_I2138-specific peptides

    • Advantages: Highly specific, can be quantitative, no antibodies needed

    • Limitations: Complex methodology, expensive equipment

This multi-technique approach allows researchers to comprehensively analyze BTH_I2138 expression at both transcriptional and translational levels, providing insights into its regulation during different growth phases or environmental conditions .

What Experimental Designs Are Most Effective for Studying the Function of BTH_I2138 in Cell Division?

To rigorously investigate BTH_I2138's role in cell division, researchers should implement systematic experimental designs that establish causal relationships:

These experimental designs should incorporate proper controls, randomization, and blinding to minimize bias. Research by the PLOS One study found that "only 12% of all 271 studies in the sample" reported random allocation, and even fewer (9%) provided details of the randomization method , highlighting the importance of methodological rigor.

How Can Single-Case Experimental Designs Be Applied to Study BTH_I2138 Function?

Single-case experimental designs (SCEDs) offer powerful approaches for studying BTH_I2138 function by enabling detailed analysis of temporal relationships and causal mechanisms:

  • ABAB Reversal Design Application:

    PhaseConditionMeasurement
    A₁ (Baseline)Wild-type BTH_I2138 expressionCell division rate, septum formation
    B₁ (Intervention)Conditional BTH_I2138 depletionCell division rate, septum formation
    A₂ (Return to baseline)Restoration of BTH_I2138 expressionCell division rate, septum formation
    B₂ (Reintroduction)Second depletion of BTH_I2138Cell division rate, septum formation

    This design provides "three replications of treatment effects (A₁ versus B₁, B₁ versus A₂, A₂ versus B₂)," establishing experimental control and demonstrating causality .

  • Multiple Baseline Design:

    • Create three bacterial cultures from the same parent culture

    • Introduce BTH_I2138 depletion at different time points for each culture

    • Monitor cell division parameters continuously across all cultures

    • Stagger intervention timing to control for time-dependent effects

  • Changing Criterion Design:

    • Use a titratable expression system for BTH_I2138

    • Gradually reduce expression levels at predetermined intervals

    • Measure corresponding changes in cell division parameters

    • Establish dose-response relationship between BTH_I2138 levels and function

  • Combined Designs:
    "Combined reversal and multiple baseline designs... focus on demonstrating experimental control of the relationship between treatment and outcome" . This approach would involve multiple bacterial cultures subjected to different sequences of BTH_I2138 modulation.

SCEDs are particularly valuable for BTH_I2138 research as they allow for precise control of experimental conditions and detailed temporal analysis of phenotypic changes, with each bacterial culture serving as its own control. These designs can "be adapted for personalized medicine" approaches and provide robust "demonstration of treatment effects" .

What Are the Challenges in Expressing Full-Length BTH_I2138 and How Can They Be Overcome?

Expressing recombinant full-length BTH_I2138 presents several technical challenges that require specific strategies:

  • Expression Challenges and Solutions:

    ChallengeSolutionMethodological Details
    Membrane protein toxicityUse specialized E. coli strainsC41(DE3) and C43(DE3) strains specifically designed for toxic membrane proteins
    Hydrophobicity issuesOptimize solubilization conditionsScreen detergents (DDM, LDAO, FC-12) for optimal extraction
    Rare codon usageCodon optimization or use of CodonPlus strainsAdapt BTH_I2138 sequence to E. coli codon bias
    Truncated productsDual-tagging strategy"Expression vectors with fusion labels on both ends can be used to distinguish full-length proteins from truncated proteins"
    Low expression levelsOptimize induction parametersReduce temperature (16-18°C), lower IPTG concentration (0.1-0.2 mM), extend induction time (18-24h)
  • Protein Structure Analysis:
    "To ensure the acquisition of full-length proteins... increasing the imidazole concentration at elution" can help separate full-length protein from truncated forms. Additionally, "to solve these problems, researchers need to analyze the protein sequence and secondary structure, and adopt corresponding strategies to optimize the expression conditions" .

  • Purification Optimization:

    • Two-step purification approach: IMAC followed by size exclusion chromatography

    • Addition of glycerol (5-10%) to all buffers to enhance stability

    • Use of protease inhibitors to prevent degradation

    • Careful pH optimization (typically pH 7.5-8.5)

  • Stabilization Strategies:

    • Reconstitution into nanodiscs or liposomes for native-like membrane environment

    • Addition of specific lipids that enhance stability

    • Use of fusion partners (MBP, SUMO) that increase solubility

    • Storage in Tris/PBS-based buffer with 6% trehalose

By systematically addressing these challenges, researchers can achieve expression of functional, full-length BTH_I2138 suitable for structural and functional studies. The methods developed for BTH_I2138 can also serve as a model for expression of other challenging membrane proteins from Burkholderia species.

How Does BTH_I2138 Expression Change During Different Growth Phases of B. thailandensis?

Understanding how BTH_I2138 expression varies across growth phases provides insights into its regulatory mechanisms and functional significance:

  • Expression Pattern Analysis:
    Based on recent transcriptome-proteome profiling in B. thailandensis during transition to stationary phase, we can infer potential BTH_I2138 expression patterns:

    Growth PhaseExpected BTH_I2138 mRNA LevelExpected BTH_I2138 Protein LevelBiological Significance
    Early exponentialModerate-highModerateActive cell division phase
    Mid-exponentialHighHighPeak division activity
    Late exponentialDecreasingSustainedPreparation for stationary phase
    Early stationaryLowModerateReduced division activity
    Late stationaryVery lowLowMinimal division

    This pattern would align with the observation that "proteins related to fatty acid degradation and butanoate metabolism accumulated along with proteins involved in synthesis of secondary metabolites" while "ribosomal proteins as well as the house-keeping iron-sulfur biogenesis proteins" were downregulated during stationary phase .

  • Methodological Approach:
    To specifically study BTH_I2138 expression:

    • Collect samples at defined time points (OD600 = 0.2, 0.5, 1.0, 1.5, 2.0)

    • Extract RNA for qRT-PCR analysis of BTH_I2138 transcripts

    • Prepare protein samples for Western blot with anti-BTH_I2138 antibodies

    • Use RNA-Seq and proteomics for global expression context

  • Regulatory Mechanisms:
    "An only modest correlation between transcriptome and proteome changes was seen, and the RpoS sigma factor was not significantly increased during early stationary phase" , suggesting that BTH_I2138 might be subject to complex post-transcriptional regulation.

  • Integration with Global Expression Data:
    The study identified "928 differentially expressed genes and 832 differentially expressed proteins" during stationary phase entry, providing context for understanding BTH_I2138 regulation within the broader cellular adaptation processes.

What is the Relationship Between BTH_I2138 and the c-di-GMP Signaling Pathway in B. thailandensis?

The potential connection between BTH_I2138 and c-di-GMP signaling represents an intriguing research direction that could reveal novel regulatory mechanisms:

  • Background on c-di-GMP Signaling in B. thailandensis:
    "As a key bacterial second messenger, cyclic di-GMP (c-di-GMP) regulates various physiological processes, such as motility, biofilm formation, and virulence. Cellular c-di-GMP levels are regulated by the opposing activities of diguanylate cyclases (DGCs) and phosphodiesterases (PDEs)" .

  • Hypothetical Connections and Experimental Approaches:

    HypothesisExperimental ApproachExpected Outcome if Positive
    BTH_I2138 is regulated by c-di-GMPMonitor BTH_I2138 expression in ΔpdcA, ΔpdcB, and ΔpdcC mutantsAltered BTH_I2138 levels in mutants compared to wild-type
    BTH_I2138 affects c-di-GMP levelsMeasure c-di-GMP in ΔBTH_I2138 mutantChanged c-di-GMP concentration in mutant
    BTH_I2138 interacts with c-di-GMP pathway componentsCo-immunoprecipitation with PdcA, PdcB, or PdcCDetection of protein-protein interactions
    BTH_I2138 mutation affects c-di-GMP-regulated phenotypesAssess biofilm formation and motility in ΔBTH_I2138Altered phenotypes similar to c-di-GMP pathway mutants
  • Methodological Details:

    • Co-immunoprecipitation: "Co-IP studies using TSHR (left panel) or CD40 antibodies (right panel) show that TSHR antibody pulls down TSHR and CD40, and CD40 antibody also pulls down both proteins, indicating physical contact between the 2 proteins"

    • Bacterial two-hybrid system: "The bacterial hybrid plasmids pKT25M-pas, pKT25M-ggdef, pKT25M-pdcB, pUT18CM-pdcB, and pUT18CM-pdcC were constructed" - similar approach could be applied to BTH_I2138

  • Potential Biological Significance:
    "The observation that homologous operons of pdcABC are widespread among betaproteobacteria and gammaproteobacteria suggests a general mechanism by which the intracellular concentration of c-di-GMP is modulated to coordinate bacterial behavior and virulence" . If BTH_I2138 interacts with this pathway, it would reveal a novel link between cell division and other bacterial behaviors regulated by c-di-GMP.

Investigating these potential connections could uncover previously unknown mechanisms coordinating cell division with biofilm formation, motility, and virulence in Burkholderia species, potentially revealing new targets for antimicrobial development.

How Can Researchers Assess the Role of BTH_I2138 in Virulence Using B. thailandensis as a Model for B. pseudomallei?

B. thailandensis provides an excellent BSL-1 model system for studying virulence mechanisms relevant to the highly pathogenic B. pseudomallei:

  • Advantages of B. thailandensis as a Model:
    "B. thailandensis could be utilized as an attractive model system to facilitate the study of the role of the Bsa TTSS during Burkholderia infection, since, in contrast to the mandated B. pseudomallei working conditions, work with B. thailandensis does not require a biosafety level 3 (BSL-3) containment facility and there is no restriction on the use of antibiotic-resistance markers for its genetic manipulation" .

  • Experimental Strategy for Assessing BTH_I2138's Role in Virulence:

    Experimental ApproachMethodologyExpected Outcome if BTH_I2138 Affects Virulence
    Generation of BTH_I2138 mutantsAllelic exchange mutagenesisClean deletion mutant with complemented control strain
    Cell invasion assaysInfection of macrophage cell lines (e.g., RAW264.7)Changes in invasion efficiency
    Intracellular replicationGentamicin protection assay with time courseAltered replication kinetics in host cells
    T3SS effector secretionWestern blot analysis of culture supernatants"BipD in the culture supernatants of relevant B. thailandensis strains was probed for using specific anti-BipD antibody... For the pellet fraction, isocitrate dehydrogenase (ICDH) was used as a loading control"
    Actin-based motilityFluorescence microscopy of infected cellsDifferences in actin tail formation
    Animal infection modelsGalleria mellonella larvae infectionAltered survival rates of infected larvae
  • T3SS Assay Details:
    "Deletion of pdcA or pdcB resulted in significantly increased secretion of BipD and deletion of pdcC leads to significantly reduced secretion of BipD compared with the wild-type strain... The expression of pdcA or pdcC in the corresponding mutant restored the secretion of BipD to wild-type levels" . Similar approaches could be used to assess if BTH_I2138 affects T3SS function.

  • Translation to B. pseudomallei:

    • Sequence comparison of BTH_I2138 with B. pseudomallei homolog

    • Conservation analysis of potential interaction partners

    • Validation of key findings in B. pseudomallei (if BSL-3 facilities available)

This systematic approach leverages the advantages of B. thailandensis while generating data relevant to understanding virulence mechanisms in the more pathogenic B. pseudomallei, potentially revealing new aspects of how cell division proteins like BTH_I2138 may influence bacterial pathogenesis.

What Techniques Can Be Used to Study Protein-Protein Interactions Involving BTH_I2138?

Investigating protein-protein interactions is crucial for understanding BTH_I2138's role in cell division networks:

  • Co-immunoprecipitation (Co-IP):

    • Methodology: "Co-IP studies using TSHR (left panel) or CD40 antibodies (right panel) show that TSHR antibody pulls down TSHR and CD40, and CD40 antibody also pulls down both proteins, indicating physical contact between the 2 proteins"

    • Application to BTH_I2138: Generate specific antibodies against BTH_I2138, perform immunoprecipitation, and identify co-precipitated proteins by mass spectrometry

    • Advantages: Detects native interactions in cellular context

    • Challenges: Requires specific antibodies, membrane protein solubilization issues

  • Bacterial Two-Hybrid System:

    • Methodology: "The bacterial hybrid plasmids pKT25M-pas, pKT25M-ggdef, pKT25M-pdcB, pUT18CM-pdcB, and pUT18CM-pdcC were constructed in similar manners by using the primers listed in Table 2"

    • Application to BTH_I2138: Create fusion constructs with BTH_I2138 and potential interacting partners

    • Advantages: Specifically designed for bacterial proteins, works well for membrane proteins

    • Challenges: May detect non-physiological interactions

  • Proximity-Dependent Biotin Identification (BioID):

    StepProcedureTechnical Considerations
    1Create fusion of BTH_I2138 with BirA* biotin ligaseConfirm functionality of fusion protein
    2Express in B. thailandensisOptimize expression level
    3Add biotin to growth mediumTypically 50 μM biotin for 24h
    4Lyse cells and purify biotinylated proteinsUse stringent washing conditions
    5Identify biotinylated proteins by mass spectrometryCompare to control samples
    • Advantages: Detects transient interactions, works in native cellular environment

    • Challenges: May identify proteins in proximity but not directly interacting

  • Förster Resonance Energy Transfer (FRET):

    • Methodology: Create fluorescent protein fusions to BTH_I2138 and candidate partners

    • Application: Express in B. thailandensis and measure energy transfer between fluorophores

    • Advantages: Can detect interactions in live cells

    • Challenges: Requires careful control experiments, potential interference of fluorescent tags

  • Cross-linking Mass Spectrometry:

    • Methodology: Treat cells with cross-linking reagents, purify BTH_I2138, digest, and identify cross-linked peptides

    • Advantages: Can capture transient interactions, identifies specific interaction sites

    • Challenges: Complex data analysis, requires high-resolution mass spectrometry

These complementary approaches provide a comprehensive strategy for mapping BTH_I2138's protein interaction network, revealing its role in cell division and potentially uncovering connections to other cellular processes such as virulence or stress response.

How Do Mutations in BTH_I2138 Affect Cell Division and Bacterial Morphology?

Systematic characterization of BTH_I2138 mutations provides critical insights into structure-function relationships:

  • Mutation Strategy and Analysis:

    Mutation TypeDesign ApproachAnalysis MethodExpected Phenotype
    Complete deletionAllelic exchangePhase contrast microscopyPotential filamentous growth or division defects
    Conserved residue substitutionsSite-directed mutagenesisTime-lapse microscopyVaried severity based on residue importance
    Domain deletionsIn-frame deletionsElectron microscopyDomain-specific functional defects
    C-terminal/N-terminal truncationsPremature stop codonsFluorescent microscopy with membrane stainsInsights into terminal region functions
  • Microscopy Analysis Protocol:

    • Fix bacterial cells with 4% paraformaldehyde

    • Stain membranes with FM4-64 (red) and DNA with DAPI (blue)

    • Image using confocal microscopy

    • Quantify cell length, width, and nucleoid positioning

    • Perform statistical analysis comparing mutants to wild-type

  • Morphological Parameters to Measure:

    ParameterMeasurement MethodSignificance
    Cell lengthPhase contrast imaging with automated cell detectionIndicates division frequency
    Cell widthPhase contrast imaging with automated cell detectionReflects cell wall synthesis
    Septum positioningMembrane stainingShows division site selection accuracy
    Nucleoid segregationDNA stainingReveals chromosome partitioning
    Z-ring formationFtsZ-GFP fusion imagingIndicates divisome assembly
  • Experimental Controls:

    • Include wild-type strain in all experiments

    • Create complemented strains expressing wild-type BTH_I2138

    • Use appropriate statistical methods with biological replicates

This approach follows experimental design principles noted in search result : "A good experimental design requires a strong understanding of the system you are studying" and incorporates the recommendation to "systematically and precisely manipulate the independent variable(s)" while "precisely measuring the dependent variable(s)" .

The resulting data would provide detailed insights into how specific regions or residues of BTH_I2138 contribute to proper cell division in B. thailandensis, potentially revealing conserved mechanisms across bacterial species.

What Are the Methodological Considerations for Integrating Transcriptomic and Proteomic Approaches to Study BTH_I2138 Function?

Integrating transcriptomic and proteomic data provides a comprehensive view of BTH_I2138's function in cellular context:

  • Experimental Design Considerations:

    Design ElementRecommendationRationale
    Comparison groupsWild-type vs. ΔBTH_I2138 mutantDirect assessment of BTH_I2138's impact
    Growth conditionsMultiple conditions (e.g., rich media, minimal media, stress)Reveals condition-specific effects
    Time pointsMultiple points during growth curveCaptures dynamic regulation
    ReplicationMinimum 3 biological replicatesEnsures statistical robustness
    ControlsInclude complemented strainConfirms phenotypes are due to BTH_I2138
  • Technical Approach:

    • Transcriptomics: "RNA sequencing (RNA-Seq) to identify differentially expressed genes"

    • Proteomics: "Mass spectrometry-based quantitative proteomics (e.g., iTRAQ, TMT, SILAC)"

    • Integration: "Correlation analysis between transcript and protein levels"

  • Expected Outcomes and Interpretation:
    Based on previous B. thailandensis studies: "We identified 928 differentially expressed genes and 832 differentially expressed proteins" and "an only modest correlation between transcriptome and proteome changes was seen" . This suggests that:

    • Post-transcriptional regulation may be important for BTH_I2138 function

    • Protein-level changes may not always reflect transcript-level changes

    • Integrated analysis is essential for complete understanding

  • Validation Approaches:

    • qRT-PCR for selected differentially expressed genes

    • Western blot for key protein changes

    • Phenotypic analysis of mutants in identified pathways

    • Protein-protein interaction studies for potential BTH_I2138 partners

This integrated approach aligns with modern systems biology practices and provides a more complete picture of BTH_I2138's role than either transcriptomics or proteomics alone, potentially revealing unexpected connections to other cellular processes and regulatory networks.

How Can Researchers Develop and Validate Specific Antibodies Against BTH_I2138?

Developing high-quality antibodies against BTH_I2138 is essential for many experimental applications:

  • Antigen Design Strategy:

    Antigen TypeAdvantagesDisadvantagesDesign Considerations
    Full-length recombinant BTH_I2138Complete epitope representationChallenging expression, hydrophobicityUse His-tag for purification, solubilize with appropriate detergents
    Synthetic peptides from hydrophilic regionsEasier production, target specific domainsLimited epitopes, may not recognize native proteinSelect 15-20aa peptides from predicted extracellular loops
    Extracellular domain fragmentsBalance between specificity and native structureExpression challengesCareful boundary selection to ensure proper folding
  • Immunization Protocol Based on BipD Antibody Development:
    "The rBipD was obtained by affinity chromatography using His Trap column, then mixed with Fredrick's adjuvant to immunize BALB/c mice by intraperitoneal injection in order to obtain anti-rBipD polyclonal antibodies" . The protocol yielded high-titer antibodies (1:512,000).

    Adapted Protocol for BTH_I2138:

    • Purify recombinant His-tagged BTH_I2138 protein

    • Mix with Freund's complete adjuvant for initial immunization

    • Boost with antigen in Freund's incomplete adjuvant at days 14, 28, and 42

    • Collect serum and test antibody titer by ELISA

    • Purify IgG fraction using protein A/G columns

  • Validation Strategy:

    Validation TestMethodologyAcceptance Criteria
    Western blot against recombinant BTH_I2138Standard Western blot protocolSingle band at expected MW (~20 kDa plus tag)
    Western blot against B. thailandensis lysatesCompare wild-type and ΔBTH_I2138 strainsBand present in wild-type, absent in knockout
    Immunofluorescence microscopyFixed B. thailandensis cellsSpecific membrane localization pattern
    Cross-reactivity testingWestern blot against related Burkholderia speciesExpected bands in species with homologous proteins
    Pre-immune serum controlAll applicationsNo specific reactivity
  • Application Optimization:

    • For Western blot: Determine optimal antibody dilution, blocking conditions

    • For immunoprecipitation: Test different lysis buffers, antibody amounts

    • For immunofluorescence: Optimize fixation method, permeabilization conditions

    • For ELISA: Establish standard curves, determine detection limits

Following these methodological steps will yield high-quality antibodies against BTH_I2138 that can be used to investigate its expression, localization, and interactions, significantly advancing research on this important cell division protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.