Recombinant Burkholderia thailandensis Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Membrane Topology

Lgt is an inner membrane protein with seven transmembrane segments in E. coli, where the N-terminus faces the periplasm and the C-terminus faces the cytoplasm . Key conserved residues critical for activity include:

  • Y26, N146, and G154: Essential for catalytic function .

  • R143, E151, R239, E243: Important for substrate binding .

These residues form a "signature motif" facing the periplasm, enabling interaction with phosphatidylglycerol and prolipoproteins .

Role in Bacterial Adaptation

While B. thailandensis Lgt has not been directly studied, its homologs in other Burkholderia species and E. coli reveal functional significance:

  • Essentiality: lgt is indispensable for bacterial growth in E. coli; depletion leads to accumulation of unmodified lipoproteins and cell death .

  • Stress Survival: In B. pseudomallei and B. thailandensis, lipoprotein modification may influence stress responses, such as:

    • Phase variation via RecA-mediated DNA recombination .

    • Starvation-induced morphological shifts (e.g., coccoid forms) .

    • SOS response activation under DNA damage .

Research Applications

Recombinant Lgt is utilized to study:

  1. Lipoprotein Biosynthesis: Mechanistic studies on lipid anchoring and membrane protein localization .

  2. Antimicrobial Targets: As a conserved enzyme, Lgt is explored for developing inhibitors against Burkholderia pathogens .

  3. Vaccine Development: Flagellin fragments from B. thailandensis (modified via Lgt-dependent pathways) show diagnostic potential for melioidosis .

Comparative Analysis with Homologs

SpeciesKey FeaturesReference
B. multivoransRecombinant Lgt (1–297 aa) expressed in E. coli; used for structural studies .
B. malleiCommercial recombinant Lgt available for ELISA-based research .
E. coliWell-characterized topology and essential residues; model for enzymatic studies .

Future Directions

  • Structural Resolution: Cryo-EM or X-ray crystallography of B. thailandensis Lgt could clarify species-specific adaptations.

  • Pathogenicity Links: Investigating Lgt’s role in B. thailandensis virulence, given its clinical isolation from wounds .

  • Therapeutic Exploration: Screening for Lgt inhibitors using recombinant protein assays .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order notes. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize its inclusion in development.
Synonyms
lgt; BTH_I0829; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-296
Protein Length
full length protein
Species
Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264)
Target Names
lgt
Target Protein Sequence
MIIHPNFDPVAIHLGPLAVRWYGLMYLVGFILAIVVGRLRLKLPHVAAQGWSAKDIDDMM FYGVLGVVLGGRLGYVLFYKADYYFSHPLDIFRVWEGGMSFHGGFLGVTLAMALFAWQRK RHWLEVTDFVAPMVPTGLAAGRLGNFINGELWGRVTSPDAPWAMLFPGASRDDAAWLAAH QDIAAKWNLNEVFLAHQMLPRHPSQLYEIALEGIALFFVLWFFSRKPRPMGAISALFLIG YGAARFTVEFAREPDDFLGLLTFGLSMGQWLSLPMIVAGVLMMIWAYRRGGAAKAA
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of lgt in Burkholderia thailandensis and how does it compare to other Burkholderia species?

Prolipoprotein diacylglyceryl transferase (lgt) in B. thailandensis is typically found within the core genome. The enzyme catalyzes a critical step in bacterial lipoprotein biosynthesis by transferring diacylglyceryl moieties to prolipoproteins containing a conserved lipobox motif. When studying lgt in B. thailandensis, it's important to consider genomic context, particularly in light of the significant genomic heterogeneity observed among B. thailandensis populations.

Research has shown that B. thailandensis E264 from ATCC represents a genotypically heterogeneous population, with some bacteria containing multiple copies of a 208.6 kb DNA region through RecA-mediated duplication events . This heterogeneity must be accounted for when designing experiments involving recombinant lgt expression, as duplicated regions may affect interpretation of results. Comparative analysis of lgt sequences across different Burkholderia strains can provide insights into evolutionary conservation of this essential enzyme.

How do different B. thailandensis sequence types impact research on recombinant lgt expression?

Recent environmental surveillance studies have identified significant genetic diversity within B. thailandensis, with multiple novel sequence types discovered through multi-locus sequence typing (MLST) and 16S rRNA analyses. For example, studies in Sierra Leone identified seven novel B. thailandensis sequence types (ST1677 through ST1683) alongside the previously described ST73 .

This genetic diversity must be considered when selecting B. thailandensis strains for recombinant lgt expression. Phylogenetic analysis has revealed two main B. thailandensis clusters: Cluster I contains isolates primarily from Asia and Oceania, while Cluster II comprises isolates from Africa (including all Sierra Leone isolates) . The genetic variability between these clusters may impact lgt expression, function, and interaction with other cellular components.

When working with recombinant lgt, researchers should document the specific B. thailandensis sequence type used and consider how sequence variations might influence experimental outcomes. This is particularly important when comparing results across different studies.

What are the fundamental differences between lgt in B. thailandensis and pathogenic Burkholderia species?

B. thailandensis is widely used as a less virulent model organism for studying more pathogenic Burkholderia species like B. pseudomallei. While B. thailandensis rarely causes disease in humans, specific sequence types have been associated with human infections, including strains from both phylogenetic clusters I and II .

Some B. thailandensis isolates express a B. pseudomallei-like capsular polysaccharide (BTCV), which may explain cross-reactivity with B. pseudomallei in latex-agglutination tests . This phenotypic similarity to pathogenic species makes certain B. thailandensis strains particularly valuable models for studying conserved proteins like lgt.

What are the optimal protocols for cloning and expressing recombinant B. thailandensis lgt?

The λ Red recombineering system has been adapted for use in naturally transformable Burkholderia species, including B. thailandensis, providing efficient methods for genetic manipulation . This approach can be applied to lgt cloning and expression as follows:

Protocol for lgt cloning from B. thailandensis:

  • Primer design: Design primers with 40-45 bp homology to the regions flanking the lgt gene, with appropriate restriction sites for subsequent cloning

  • Template preparation: Extract genomic DNA from a well-characterized B. thailandensis strain (document the specific sequence type)

  • PCR amplification: Use high-fidelity polymerase to amplify the lgt gene

  • Cloning verification: Sequence the amplified product to confirm the absence of mutations

  • Expression vector selection: Choose an appropriate expression system based on downstream applications (e.g., pET system for E. coli expression)

Researchers should consider codon optimization when expressing B. thailandensis lgt in heterologous hosts like E. coli, as codon usage bias may affect expression levels and protein folding.

For in vivo studies, the pull-out (PO) recombineering approach described for Burkholderia can be adapted for lgt manipulation. This method uses PCR fragments with oriT-ColE1ori-gat-ori1600-rep components flanked by 40-45 bp homologies to targeted regions . The advantage of this approach is that it allows downstream manipulation of the gene in E. coli.

How can RecA-dependent recombination influence lgt knockout experiments in B. thailandensis?

When designing knockout experiments for lgt in B. thailandensis, researchers must consider the role of RecA-dependent recombination, which has been shown to influence genomic architecture and bacterial phenotypes.

Studies have demonstrated that RecA-mediated homologous recombination facilitates substantial genomic rearrangements in B. thailandensis, including duplication and subsequent resolution of large DNA regions . This natural recombination system can complicate genetic manipulation experiments if not properly controlled.

For lgt knockout studies, the following approach is recommended:

  • Control for RecA activity: Include RecA-deficient strains (∆recA::nptII) alongside wildtype strains to assess the impact of recombination

  • Monitor genetic stability: Use PCR-based junction assays to track potential recombination events during experimental timeframes

  • Complementation controls: Include complemented recA strains (∆recA::nptII attTn7::recA) to confirm phenotypes are specifically linked to RecA activity

A study using a gusA reporter system demonstrated that resolution of tandem duplications to a single copy occurred through RecA-dependent homologous recombination, with the proportion of strains maintaining duplications dropping from 100% to approximately 10% over 30 days in wild-type but not in RecA-deficient strains . This temporal aspect of genomic instability must be considered when designing long-term experiments with lgt knockout strains.

What is the most efficient method for generating a targeted lgt knockout in B. thailandensis?

For generating targeted knockouts of lgt in B. thailandensis, the λ Red system has been adapted for use with naturally transformable Burkholderia species. This approach is more efficient than traditional methods and can be completed in approximately 10 days .

Protocol for lgt knockout using λ Red recombineering:

  • PCR template selection: Use a pheS-gat cassette as template, which provides both negative (pheS) and positive (gat) selection markers

  • Primer design: Create primers with 40-45 bp homology to regions flanking the lgt gene

  • PCR amplification: Generate the knockout cassette with flanking homologies

  • Recombination: Introduce the PCR product into B. thailandensis cells expressing λ Red proteins

  • Selection: Plate on glyphosate-containing medium to select for recombinants

  • Verification: Confirm knockouts using PCR across junction regions and sequencing

This approach offers several advantages over traditional methods:

  • Smaller PCR products reduce primer numbers and amplification steps

  • One-step recombination increases efficiency

  • Flexible selection systems allow for further genetic manipulation

For cases where complete lgt deletion might be lethal, consider conditional knockout strategies or partial gene deletions targeting specific functional domains.

How can phase variation mechanisms in B. thailandensis impact studies of recombinant lgt expression?

B. thailandensis employs phase variation mechanisms to adapt to fluctuating environmental conditions. Research has identified a specific phase variation system involving RecA-mediated homologous recombination between insertion sequence (IS) elements, which generates genotypically and phenotypically heterogeneous populations .

When studying recombinant lgt expression, researchers must consider how phase variation might affect:

  • Gene dosage effects: Duplication of genomic regions may alter copy number of genes involved in lgt regulation or lipoprotein biosynthesis

  • Population heterogeneity: Experiments may yield inconsistent results if conducted with mixed populations at different phases

  • Environmental adaptation: Expression conditions may select for specific genomic states

To control for these variables, researchers should:

  • Screen colonies for genomic state using PCR-based detection of junction sequences

  • Track potential recombination events during experimental timeframes

  • Consider single-cell approaches to distinguish population-level from individual cell effects

Interestingly, when colony biofilms of specific B. thailandensis cells were grown at room temperature for extended periods (>4 weeks), brownish-gold spots appeared in the center, suggesting that duplication of certain genomic regions occurs preferentially in specific microenvironments . This spatial heterogeneity should be considered when harvesting cells for recombinant protein expression.

What approaches can be used to study the interactions between lgt and the B. thailandensis membrane proteome?

Studying interactions between lgt and the B. thailandensis membrane proteome requires specialized techniques to capture the complexity of membrane protein networks. The following approaches are recommended:

1. Proximity-based labeling:

  • Express lgt fused to a proximity labeling enzyme (BioID or APEX2)

  • Identify proximal proteins through biotinylation and mass spectrometry

  • Validate interactions through co-immunoprecipitation

2. Comparative proteomics:

  • Compare membrane proteomes between wildtype and lgt-depleted strains

  • Identify lipoproteins with altered processing or localization

  • Quantify abundance changes using stable isotope labeling

3. Structural biology approaches:

  • Express and purify recombinant lgt with interacting partners

  • Use cryo-EM or X-ray crystallography to determine complex structures

  • Perform molecular dynamics simulations to model membrane insertion

When designing these experiments, researchers should consider the genetic and phenotypic heterogeneity observed in B. thailandensis populations. Different sequence types may exhibit variations in membrane composition or lipoprotein profiles . Additionally, the RecA-dependent phase variation can lead to duplication of genomic regions, potentially affecting membrane protein expression .

What are the best strategies for investigating lgt substrate specificity across diverse B. thailandensis strains?

Investigating lgt substrate specificity across diverse B. thailandensis strains requires systematic approaches that account for genetic diversity and potential functional variations:

1. Comparative genomics approach:

  • Analyze predicted lipoprotein sequences across different B. thailandensis sequence types

  • Compare lipobox motifs for conservation and variation

  • Create a database of potential lgt substrates specific to each strain

2. Heterologous expression system:

  • Express recombinant lgt from different B. thailandensis sequence types in a common host

  • Test activity against a panel of synthetic lipobox-containing peptides

  • Quantify reaction rates and substrate preferences

3. In vivo labeling techniques:

  • Metabolically label lipoproteins using azide-modified fatty acids

  • Perform click chemistry to identify lipidated proteins

  • Compare lipoprotein profiles across strains using proteomics

Research has identified distinct phylogenetic clusters within B. thailandensis, with Cluster I containing isolates primarily from Asia and Oceania, and Cluster II comprising isolates from Africa . These genetic differences may translate to variations in lgt activity or substrate recognition, particularly if they affect membrane composition or lipoprotein processing pathways.

How can researchers resolve contradictory phenotypic data when studying lgt mutants in B. thailandensis?

Contradictory phenotypic data is a common challenge when studying lgt mutants in B. thailandensis, often stemming from the organism's complex adaptive mechanisms and population heterogeneity. To resolve such contradictions, implement the following strategies:

1. Genetic background verification:

  • Confirm the exact sequence type and lineage of your B. thailandensis strain

  • Verify the genomic context of lgt (single copy vs. duplicated regions)

  • Screen for spontaneous suppressors or compensatory mutations

2. Environmental variable control:

  • Standardize growth conditions precisely (temperature, media composition, oxygen levels)

  • Test phenotypes across multiple environmental conditions

  • Consider biofilm vs. planktonic growth states, as duplications are enriched in biofilm centers

3. Population heterogeneity assessment:

  • Implement single-cell analysis techniques (flow cytometry, microscopy)

  • Isolate and characterize subpopulations with distinct phenotypes

  • Use reporter constructs to visualize gene expression heterogeneity

4. Temporal considerations:

  • Track phenotypes over time, as RecA-dependent recombination can alter population composition

  • Use inducible expression systems to control timing of lgt disruption

  • Consider adaptive responses that may mask initial phenotypes

Research has shown that RecA-mediated recombination in B. thailandensis can lead to resolution of tandem duplications over time, changing from 100% to approximately 10% in 30 days . This temporal dynamic must be considered when interpreting seemingly contradictory phenotypic data from experiments conducted at different timepoints.

What statistical approaches are most appropriate for analyzing variability in lgt expression across different B. thailandensis sequence types?

When analyzing variability in lgt expression across different B. thailandensis sequence types, researchers should employ statistical approaches that account for both biological variation and the hierarchical structure of genetic relationships:

1. Hierarchical mixed-effects models:

  • Incorporate phylogenetic relationships as random effects

  • Account for nested sources of variation (clusters, sequence types, strains)

  • Test for significant differences while controlling for genetic relatedness

2. Comparative expression analysis:

  • Normalize expression data using appropriate reference genes

  • Apply ANOVA with post-hoc tests for multiple sequence type comparisons

  • Use non-parametric alternatives (Kruskal-Wallis) for non-normally distributed data

3. Multivariate approaches:

  • Employ principal component analysis to identify patterns across sequence types

  • Use partial least squares discriminant analysis to identify expression signatures

  • Develop predictive models relating sequence variations to expression differences

When conducting these analyses, researchers should consider the phylogenetic structure of B. thailandensis populations. Studies have identified two main clusters through MLST analysis, with Cluster I containing isolates from Asia and Oceania, and Cluster II comprising isolates from Africa . Statistical analyses should account for this hierarchical structure to avoid confounding geographical and genetic factors.

How can researchers differentiate between direct and indirect effects when analyzing phenotypes of B. thailandensis lgt mutants?

Differentiating between direct and indirect effects of lgt mutation requires systematic approaches that isolate specific causative relationships from broader systemic changes:

1. Complementation analysis:

  • Restore wildtype lgt under native or inducible promoters

  • Create point mutations affecting specific lgt functions

  • Introduce orthologous lgt from related species for functional complementation

2. Temporal analysis of effects:

  • Implement time-course experiments after lgt disruption

  • Identify primary effects (immediate) versus secondary adaptations

  • Use pulse-chase approaches to track lipoprotein maturation kinetics

3. Pathway dissection:

  • Target specific steps in lipoprotein processing pathway (lsp, lnt)

  • Create double mutants to identify genetic interactions

  • Use chemical inhibitors with different mechanisms to validate genetic findings

4. Systems biology approach:

  • Integrate transcriptomics, proteomics, and metabolomics data

  • Construct network models to identify direct versus indirect effects

  • Apply causal inference statistical methods to differentiate correlation from causation

When interpreting results, researchers should consider that B. thailandensis employs phase variation mechanisms that generate phenotypically heterogeneous populations . This inherent heterogeneity may complicate the differentiation of direct lgt effects from broader adaptive responses. Additionally, the genetic diversity across B. thailandensis sequence types may influence how disruption of lgt affects cellular processes, requiring careful consideration of strain-specific contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.