Recombinant Burkholderia thailandensis Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Burkholderia thailandensis Protease HtpX Homolog (htpX)

The Recombinant Burkholderia thailandensis Protease HtpX homolog (htpX) is a recombinant protein derived from Burkholderia thailandensis, a bacterium closely related to the more virulent Burkholderia pseudomallei and Burkholderia mallei. Burkholderia thailandensis is often used as a model organism in research due to its lower pathogenicity and biosafety level 2 (BSL-2) requirements, making it easier to study than its more virulent relatives .

Key Features of Recombinant Burkholderia thailandensis Protease HtpX Homolog (htpX)

  • Species: Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301)

  • Protein Type: Recombinant Protein

  • Tag Information: The tag type is determined during the production process.

  • Storage Buffer: Tris-based buffer with 50% glycerol, optimized for protein stability.

  • Storage Conditions: Store at -20°C for short-term storage or -80°C for extended storage. Avoid repeated freezing and thawing.

  • Working Aliquots: Store at 4°C for up to one week .

Quorum Sensing and Secondary Metabolites

Quorum sensing plays a crucial role in regulating behaviors such as biofilm formation and secondary metabolite production in Burkholderia species . Disrupting quorum sensing can significantly alter bacterial behavior, including antimicrobial activity .

Table 1: Key Features of Recombinant Burkholderia thailandensis Protease HtpX Homolog (htpX)

FeatureDescription
SpeciesBurkholderia thailandensis (strain E264)
Protein TypeRecombinant Protein
Storage BufferTris-based buffer with 50% glycerol
Storage Conditions-20°C or -80°C
Tag InformationDetermined during production

Table 2: Amino Acid Sequence of Recombinant Burkholderia thailandensis Protease HtpX Homolog (htpX)

Sequence SegmentAmino Acid Sequence
Full SequenceMFNWVKTAmLMAAITALFIVIGGMIGGSRGMTIALLIALGMNFFSYWFSDKMVLRMYNAQ EVDETTAPQFYRMVRELATRANLPMPRVYLIDESQPNAFATGRNPEHAAVAATTGILRVL SEREMRGVMAHELAHVKHRDILISTISATMAGAISALANFAMFFGGRDENGRPANPIAGI AVALLAPIAGALIQMAISRAREFEADRGGAQISGDPQALASALDKIHRYASGIPFQTAEE HPATAQMMIMNPLSGGGLQNLFSTHPATEERIARLMEMARTGRFD

Future Research Directions

  1. Proteomic Analysis: Further studies could focus on integrating proteomic data to understand the role of HtpX in B. thailandensis.

  2. Functional Characterization: Investigating the enzymatic activity and substrate specificity of HtpX could reveal its biological functions.

  3. Pathogenicity Studies: Exploring how HtpX contributes to the virulence or survival strategies of Burkholderia species could provide valuable insights into disease mechanisms.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will do our best to fulfill your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipment is required, please contact us in advance as additional charges may apply.
Notes
Repeated freezing and thawing should be avoided. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For ease of reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution. Store at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life of our proteins is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C, while lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. To maintain product integrity, avoid repeated freeze-thaw cycles.
Tag Info
The specific tag type will be determined during the manufacturing process.
While we strive to accommodate specific tag type requests, please inform us of your desired tag during the ordering process so we can prioritize its development.
Synonyms
htpX; BTH_I0131; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
full length protein
Species
Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264)
Target Names
htpX
Target Protein Sequence
MFNWVKTAMLMAAITALFIVIGGMIGGSRGMTIALLIALGMNFFSYWFSDKMVLRMYNAQ EVDETTAPQFYRMVRELATRANLPMPRVYLIDESQPNAFATGRNPEHAAVAATTGILRVL SEREMRGVMAHELAHVKHRDILISTISATMAGAISALANFAMFFGGRDENGRPANPIAGI AVALLAPIAGALIQMAISRAREFEADRGGAQISGDPQALASALDKIHRYASGIPFQTAEE HPATAQMMIMNPLSGGGLQNLFSTHPATEERIARLMEMARTGRFD
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Burkholderia thailandensis Protease HtpX homolog and what is its biochemical classification?

The Burkholderia thailandensis Protease HtpX homolog is a zinc metalloproteinase belonging to the M48 family. It functions as a membrane protease involved in protein quality control, primarily targeting misfolded or misassembled membrane proteins. The enzyme is classified under EC 3.4.24.- (metalloendopeptidases) and is encoded by the htpX gene (locus tag BTH_I0131) in the B. thailandensis genome. The protease contains conserved domains characteristic of zinc-dependent proteases and is integrated into the cytoplasmic membrane with multiple transmembrane segments .

How does the structure of B. thailandensis HtpX compare to HtpX homologs in other bacterial species?

The B. thailandensis HtpX shares structural similarities with other bacterial HtpX homologs, particularly with the well-studied E. coli variant. Both contain four hydrophobic regions that likely serve as transmembrane segments, though there is some controversy regarding whether the two C-terminal regions are embedded in the membrane in all species. The full-length protein consists of 285 amino acids with a sequence that includes the characteristic HEXXH motif common to zinc metalloproteinases. Structurally, these proteases typically have their catalytic domain facing the cytoplasm, allowing them to interact with cytoplasmic regions of membrane proteins that require quality control surveillance .

What is the ecological and pathogenic significance of Burkholderia thailandensis?

Burkholderia thailandensis is a non-pathogenic soil-dwelling bacterium that is genetically closely related to Burkholderia pseudomallei, the causative agent of melioidosis. While B. thailandensis itself is considered non-pathogenic, some strains express a B. pseudomallei-like capsular polysaccharide (referred to as BTCV). These strains have been detected in rice fields in East and Central Thailand, though not in Northeast Thailand. The distribution patterns of B. thailandensis, including its capsular variant, provide important ecological context for understanding environmental bacterial adaptations. Despite its genetic similarity to B. pseudomallei, serological studies indicate that exposure to B. thailandensis does not significantly influence immune responses to B. pseudomallei, as measured by indirect hemagglutination assay (IHA) titers .

How can codon optimization improve the expression of recombinant B. thailandensis HtpX in heterologous systems?

Codon optimization is crucial when expressing B. thailandensis HtpX in heterologous systems like E. coli due to potential codon usage bias between the two organisms. The difference in frequency of synonymous codon usage between B. thailandensis and E. coli can lead to translation pauses, amino acid misincorporation, or truncation of the polypeptide during expression. To address this, two primary strategies can be employed: (1) codon optimization of the htpX gene to match E. coli's codon usage patterns, or (2) co-expression of rare tRNAs through host modification.

For codon optimization, beyond the simple "one amino acid-one codon" approach, more sophisticated algorithms that consider parameters such as codon context and codon harmonization should be utilized. This optimization process can significantly enhance expression levels without altering the amino acid sequence of the protein. When implementing this approach for B. thailandensis HtpX, particular attention should be paid to arginine codons (like AGG), which are used at very different frequencies in E. coli (<0.2%) compared to other organisms .

What purification strategy yields the highest purity and activity retention for recombinant HtpX protease?

A systematic purification strategy for recombinant B. thailandensis HtpX should consider both its membrane-associated nature and metalloprotease characteristics. The recommended approach involves:

  • Expression with an appropriate affinity tag (His-tag is commonly used as indicated in the literature)

  • Cell lysis under conditions that preserve the native protein conformation

  • Membrane fraction isolation through differential centrifugation

  • Solubilization using appropriate detergents (typically mild non-ionic detergents)

  • Immobilized metal affinity chromatography (IMAC) for initial purification

  • Size exclusion chromatography for further purification and detergent exchange

Throughout all purification steps, it's essential to maintain zinc ions in the buffers to preserve the metalloprotease activity. Additionally, protease inhibitors should be selectively used (avoiding metalloprotease inhibitors like EDTA) to prevent degradation during purification. The purified protein should be stored in Tris-based buffer with 50% glycerol as indicated in commercial preparations. For long-term storage, -20°C or -80°C is recommended, while avoiding repeated freeze-thaw cycles. Working aliquots can be maintained at 4°C for up to one week to preserve activity .

What methods are available for measuring the proteolytic activity of recombinant HtpX in vitro?

Several methodological approaches can be employed to measure the proteolytic activity of recombinant HtpX, with recent advances providing more sensitive and specific assays:

  • Synthetic Peptide Substrates: Fluorogenic or chromogenic peptides containing known cleavage sequences can be used to measure activity through spectrophotometric or fluorometric detection.

  • Model Substrate Systems: As demonstrated in recent research, engineered model substrates specifically designed for HtpX can provide semiquantitative and convenient protease activity assessment. These systems often incorporate reporter proteins that generate detectable signals upon cleavage.

  • In vitro Membrane Protein Degradation Assays: Using purified membrane proteins as substrates and monitoring their degradation through techniques such as SDS-PAGE and Western blotting.

  • In vivo Activity Assays: The recently developed in vivo protease activity assay system for HtpX enables detection of differential protease activities, including those of HtpX mutants carrying mutations in conserved regions. This approach allows for characterization of HtpX function in a cellular context rather than with isolated proteins .

The choice of assay depends on the specific research question, with in vivo systems providing more physiologically relevant information but in vitro systems offering greater control over experimental conditions.

How can one design experiments to identify the natural substrates of B. thailandensis HtpX protease?

Identifying natural substrates of B. thailandensis HtpX requires a multifaceted experimental approach:

  • Comparative Proteomics: Analyze the membrane proteome of wild-type B. thailandensis versus htpX deletion mutants using quantitative proteomics approaches such as SILAC (Stable Isotope Labeling with Amino acids in Cell culture) or TMT (Tandem Mass Tag) labeling. Proteins that accumulate in the deletion mutant are potential substrates.

  • Substrate Trapping: Generate a catalytically inactive HtpX variant by mutating the active site residues. This "trap" can still bind but not process substrates, allowing for co-immunoprecipitation followed by mass spectrometry identification.

  • In vivo Crosslinking: Use chemical crosslinkers to capture transient enzyme-substrate interactions in living cells, followed by affinity purification and identification.

  • Degradomics Approaches: Employ N-terminomics or C-terminomics to identify protein fragments generated by HtpX cleavage, thus mapping potential substrate recognition motifs.

  • Bioinformatic Prediction: Analyze the B. thailandensis proteome for proteins that match known substrate characteristics of HtpX homologs from other species, particularly focusing on membrane proteins with potentially misfolded domains.

After identifying candidate substrates, validation experiments should be performed, including in vitro cleavage assays with purified components and in vivo substrate stability studies comparing wild-type and htpX mutant backgrounds .

What experimental strategies can determine the precise cleavage sites and substrate specificity of HtpX?

Determining the precise cleavage sites and substrate specificity of HtpX requires methodical experimental approaches:

  • Edman Sequencing: After in vitro cleavage of purified substrates, N-terminal sequencing of the resulting fragments can identify exact cleavage sites.

  • Mass Spectrometry Analysis: High-resolution MS/MS analysis of digestion products can map cleavage sites with amino acid resolution. Techniques such as MALDI-TOF MS or LC-MS/MS are particularly useful.

  • Peptide Library Screening: Systematically testing HtpX against synthetic peptide libraries can reveal sequence preferences around the cleavage site.

  • Site-Directed Mutagenesis of Substrates: Creating point mutations in suspected cleavage regions of known substrates and assessing how these affect processing can confirm site specificity.

  • Structural Analysis: Computational modeling of substrate-enzyme interactions based on available structural data can provide insights into the molecular determinants of specificity.

  • Protease Protection Assays: These can help determine which regions of membrane protein substrates are accessible to HtpX, providing contextual information about cleavage in the native membrane environment.

By combining these approaches, researchers can develop a comprehensive understanding of both the sequence and structural requirements for HtpX substrate recognition and processing .

How can homology modeling and structural analysis improve our understanding of HtpX function?

Homology modeling and structural analysis provide critical insights into HtpX function through several sophisticated approaches:

  • Comparative Modeling: Using the recently improved homolog detection methods based on deep learning language models, researchers can identify distant homologs of HtpX with known structures, even when sequence identity is below 30%. This approach is particularly valuable for membrane proteins like HtpX, which are challenging to crystallize.

  • Transmembrane Topology Prediction: Advanced algorithms can predict the orientation of HtpX's transmembrane helices, resolving controversies about whether all four hydrophobic regions, particularly the two C-terminal ones, are actually embedded in the membrane.

  • Active Site Characterization: Structural modeling can identify the spatial arrangement of the catalytic zinc ion coordination site and substrate-binding pocket, providing insights into mechanism.

  • Molecular Dynamics Simulations: These can model how HtpX might interact with membrane substrates in a lipid bilayer environment, accounting for membrane fluidity and protein dynamics.

  • Structure-Guided Mutagenesis: Based on structural predictions, researchers can design targeted mutations to test hypotheses about catalytic mechanisms and substrate recognition.

These computational approaches complement experimental data and can guide the design of more efficient activity assays and substrate identification strategies. They are particularly valuable when working with challenging membrane proteases like HtpX, where traditional structural biology techniques face limitations .

What role might HtpX play in bacterial stress response and adaptation to environmental conditions?

The role of HtpX in bacterial stress response and environmental adaptation is multifaceted:

  • Heat Stress Response: As suggested by its name (HtpX - Heat shock protein X), this protease likely contributes to managing protein damage during thermal stress. Research should investigate expression levels and substrate profiles under varying temperature conditions.

  • Membrane Protein Quality Control: HtpX functions in coordination with other proteases to remove misfolded or damaged membrane proteins, particularly when primary quality control systems are overwhelmed. This function becomes critical under stress conditions that promote protein misfolding.

  • Environmental Adaptation: B. thailandensis inhabits soil environments and can be found in rice fields across different regions of Thailand. The protease may contribute to adaptation to these diverse microenvironments by regulating membrane protein composition in response to changing conditions.

  • Interspecies Comparison: Experimental approaches should include comparative analysis of HtpX function across different Burkholderia species, particularly contrasting the non-pathogenic B. thailandensis with the pathogenic B. pseudomallei to understand whether HtpX contributes to differences in environmental persistence or host interactions.

  • Stress Response Network Integration: Research should examine how HtpX activity is coordinated with other stress response systems through approaches such as transcriptomic analysis under various stress conditions and genetic interaction studies with other stress response components.

The environmental distribution patterns of B. thailandensis across different regions in Thailand provide a natural laboratory for studying how HtpX function might vary across environmental gradients, potentially contributing to bacterial adaptation to different soil conditions .

How does the function of HtpX in B. thailandensis compare to its homologs in pathogenic Burkholderia species?

Comparative analysis of HtpX function between non-pathogenic B. thailandensis and pathogenic Burkholderia species reveals important evolutionary and functional insights:

  • Sequence Conservation Analysis: While the catalytic domains of HtpX are likely conserved across Burkholderia species, detailed sequence alignment and conservation analysis may reveal species-specific adaptations, particularly in substrate recognition regions.

  • Expression Pattern Differences: Investigation of htpX expression under different conditions (temperature, pH, oxidative stress) may reveal differential regulation between pathogenic and non-pathogenic species, potentially correlating with their distinct ecological niches.

  • Substrate Repertoire Comparison: The recently developed in vivo activity assay system for HtpX could be adapted to compare substrate preferences between homologs from different species, potentially revealing specialization for specific membrane protein targets.

  • Contribution to Virulence: While B. thailandensis is non-pathogenic, comparative studies with pathogenic species like B. pseudomallei could determine whether HtpX processes virulence-associated membrane proteins in the latter, contributing to pathogenicity.

  • Deletion Phenotype Analysis: Comparative phenotyping of htpX deletion mutants across different Burkholderia species under various stress conditions could reveal species-specific functional dependencies.

This comparative approach is particularly valuable given the genetic similarity but functional differences between B. thailandensis and B. pseudomallei, potentially providing insights into how conserved proteolytic systems are adapted for different ecological strategies .

What are the common challenges in expressing recombinant membrane proteases like HtpX and how can they be overcome?

Expressing recombinant membrane proteases like HtpX presents several technical challenges that require specialized approaches:

  • Protein Toxicity: Overexpression of membrane proteases often results in toxicity to the host cell. This can be addressed by:

    • Using tightly regulated promoters such as the rhamnose-inducible rhaBAD system, which allows fine-tuning of expression levels

    • Employing specialized E. coli strains like C41(DE3) and C43(DE3) that are more tolerant to toxic membrane protein expression

    • Utilizing lower growth temperatures (16-25°C) during induction to slow protein synthesis and facilitate proper folding

  • Codon Usage Bias: The difference in codon frequency between B. thailandensis and expression hosts like E. coli can lead to translation issues. Solutions include:

    • Codon optimization of the htpX gene using advanced algorithms that consider both codon frequency and context

    • Co-expression of rare tRNAs through host strains containing plasmids like pRARE

  • Membrane Integration: Ensuring proper folding and membrane integration of HtpX requires:

    • Using leader sequences that target the protein to the membrane

    • Careful selection of detergents for extraction that maintain native conformation

    • Optimizing induction timing and strength to prevent overwhelming the membrane protein insertion machinery

  • Active Conformation Preservation: Maintaining the zinc-dependent activity throughout expression and purification necessitates:

    • Supplementation of growth media and purification buffers with appropriate concentrations of zinc

    • Avoiding metal chelators like EDTA in purification steps

    • Validating proper folding through activity assays after each purification step

How can researchers troubleshoot inactive or poorly active recombinant HtpX preparations?

When faced with inactive or poorly active recombinant HtpX preparations, systematic troubleshooting approaches should be employed:

  • Metal Cofactor Analysis:

    • Verify zinc content through atomic absorption spectroscopy or colorimetric assays

    • Test activity restoration by adding various concentrations of zinc to the purified enzyme

    • Examine the effect of other divalent metals to determine if zinc has been substituted

  • Protein Folding Assessment:

    • Analyze secondary structure through circular dichroism spectroscopy

    • Verify membrane insertion patterns using protease protection assays

    • Employ thermal shift assays to determine stability and proper folding

  • Detergent Optimization:

    • Screen multiple detergent types and concentrations for optimal activity preservation

    • Consider detergent exchange during purification to find the most suitable micelle environment

    • Test reconstitution into liposomes or nanodiscs to provide a more native-like membrane environment

  • Activity Assay Conditions:

    • Optimize buffer conditions (pH, ionic strength, reducing agents)

    • Screen different substrate concentrations to ensure detection is occurring in the linear range

    • Compare activity using multiple substrate types (synthetic peptides vs. protein substrates)

  • Expression System Reevaluation:

    • Test expression in different E. coli strains specifically designed for membrane proteins

    • Consider alternative expression hosts, such as Pseudomonas or other Gram-negative bacteria that may provide a more suitable membrane environment

    • Adjust induction parameters (temperature, duration, inducer concentration) to promote proper folding

What methodological approaches can resolve contradictory results in HtpX substrate specificity studies?

Resolving contradictory results in HtpX substrate specificity studies requires rigorous methodological approaches:

  • Standardization of Experimental Conditions:

    • Develop a consensus protocol for HtpX activity assays that controls for buffer composition, detergent type, metal cofactor concentration, and temperature

    • Create reference substrate standards that can be shared between laboratories

    • Establish quantitative benchmarks for activity comparison

  • Multi-technique Validation:

    • Confirm substrate cleavage using orthogonal detection methods (e.g., Western blotting, mass spectrometry, and fluorogenic substrate assays)

    • Verify direct enzyme-substrate interaction through techniques like surface plasmon resonance or microscale thermophoresis

    • Validate in vitro findings with in vivo approaches like the recently developed HtpX activity assay system

  • Systematic Mutagenesis Studies:

    • Generate a comprehensive panel of active site mutations to correlate structural features with substrate preferences

    • Create chimeric proteins between HtpX homologs with different reported specificities to map determinants of selectivity

    • Perform alanine scanning of potential substrate recognition motifs

  • Contextual Analysis:

    • Examine how membrane environment (lipid composition, fluidity) affects substrate selection

    • Investigate the impact of stress conditions on substrate repertoire

    • Study how interactions with other cellular components might modulate specificity

  • Bioinformatic Integration:

    • Apply machine learning approaches to identify patterns in confirmed substrates that might explain apparent contradictions

    • Use evolutionary analysis to determine if substrate divergence correlates with HtpX sequence divergence across species

    • Employ molecular modeling to rationalize observed specificity differences based on structural features

How might HtpX function be harnessed for biotechnological applications?

The unique properties of HtpX as a membrane-integrated zinc metalloprotease open several biotechnological possibilities:

  • Engineered Proteolytic Systems:

    • Development of chimeric proteases combining HtpX's membrane association with alternative specificity domains for targeted degradation of specific membrane proteins

    • Creation of synthetic protein quality control circuits in bacterial expression systems to improve recombinant membrane protein production

    • Design of HtpX variants with expanded substrate specificity for biotechnological applications requiring membrane protein processing

  • Biosensor Development:

    • Utilization of HtpX's substrate recognition properties to develop sensors for membrane protein misfolding or damage

    • Creation of reporter systems based on engineered HtpX substrates that generate signals upon cleavage, potentially for monitoring cellular stress responses

    • Development of high-throughput screening platforms for compounds affecting membrane protein quality control

  • Protein Engineering Tools:

    • Application as a selective protease for removing purification tags from membrane proteins while they remain in a membrane environment

    • Use in controlled limited proteolysis for structural studies of membrane proteins

    • Development as a tool for topology mapping of complex membrane proteins

The recently developed in vivo semiquantitative and convenient protease activity assay system for HtpX provides an excellent foundation for these applications, offering a platform for testing engineered variants and monitoring activity in different contexts .

What emerging technologies could advance the structural and functional characterization of HtpX and related membrane proteases?

Several cutting-edge technologies are poised to revolutionize our understanding of HtpX and related membrane proteases:

  • Cryo-Electron Microscopy Advances:

    • Single-particle cryo-EM with improved detectors and processing algorithms enables visualization of smaller membrane proteins

    • Cryo-electron tomography can reveal HtpX organization in its native membrane context

    • Correlative light and electron microscopy can connect functional states with structural arrangements

  • Integrative Structural Biology:

    • Combining data from multiple experimental approaches (crosslinking-mass spectrometry, EPR spectroscopy, hydrogen-deuterium exchange) with computational modeling

    • Applying deep learning approaches like AlphaFold2 to predict structure of HtpX and its complexes with higher accuracy

    • Utilizing improved homolog detection methods based on protein representations from deep learning language models to identify distant structural relatives

  • Advanced Proteomics Techniques:

    • Proximity labeling approaches (BioID, APEX) to map HtpX interaction networks in living cells

    • Targeted proteomics using parallel reaction monitoring (PRM) to quantify specific cleavage events with high sensitivity

    • Top-down proteomics to characterize proteoforms and post-translational modifications of HtpX

  • Single-Molecule Techniques:

    • Single-molecule FRET to monitor conformational changes during substrate binding and catalysis

    • Nanopore recording to detect individual proteolytic events

    • High-speed AFM to visualize HtpX dynamics in membrane mimetics

  • Synthetic Biology Approaches:

    • Minimal systems reconstitution of membrane protein quality control networks

    • Cell-free expression systems optimized for membrane proteins to rapidly test HtpX variants

    • Directed evolution platforms to engineer HtpX variants with novel properties or improved activity

What insights could comparative genomics of HtpX across bacterial species provide about bacterial adaptation and evolution?

Comparative genomics of HtpX across bacterial species offers rich potential for understanding bacterial adaptation and evolution:

  • Evolutionary Trajectory Analysis:

    • Phylogenetic analysis of HtpX across different bacterial phyla can reveal patterns of vertical inheritance versus horizontal gene transfer

    • Investigation of selection pressures on different domains of HtpX may identify regions under positive selection, potentially indicating adaptation to different membrane compositions or substrate repertoires

    • Synteny analysis of the genomic neighborhood of htpX genes may reveal co-evolution with functional partners

  • Ecological Adaptation Signatures:

    • Correlation of HtpX sequence variations with bacterial ecological niches (soil-dwelling, host-associated, extremophiles)

    • Examination of HtpX conservation patterns among Burkholderia species from different geographical regions, such as the distribution patterns observed in Thailand rice fields

    • Analysis of whether capsular polysaccharide-expressing variants of B. thailandensis (BTCV) show distinctive HtpX characteristics

  • Pathogenicity Correlation:

    • Systematic comparison between HtpX homologs from pathogenic species (like B. pseudomallei) and non-pathogenic relatives (like B. thailandensis) may reveal adaptations related to host interaction

    • Investigation of whether HtpX sequence or expression patterns correlate with virulence across different bacterial pathogens

    • Analysis of host immune responses to different bacterial HtpX variants

  • Functional Network Evolution:

    • Mapping the co-evolution of HtpX with other components of membrane protein quality control systems

    • Identification of lineage-specific additions or losses in the HtpX interaction network

    • Investigation of compensatory mechanisms in species with divergent or absent HtpX homologs

This comparative approach, enhanced by improved homolog detection methods from deep learning language models, could provide insights into how this conserved protease has been adapted for diverse bacterial lifestyles and environmental challenges .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.