Recombinant Burkholderia thailandensis Secretion apparatus protein BsaZ (bsaZ)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Pathogenesis

BsaZ facilitates effector protein translocation into host cells, enabling:

  • Vacuolar escape: Mutants lacking BsaZ exhibit delayed escape from endocytic compartments in macrophages, impairing intracellular replication .

  • Actin-based motility: BsaZ-deficient strains fail to polymerize host actin for cytoplasmic movement .

  • Cytokine modulation: BsaZ influences TNF-α, IL-6, and GM-CSF secretion during macrophage infection .

Key Findings from Mutant Studies:

StrainPhenotypeHost Cell Model
B. thailandensis ΔbsaZReplication defect in HeLa cellsEpithelial cells
B. pseudomallei ΔbsaZDelayed vacuolar escape in RAW 264.7Murine macrophages
ΔbsaZ complementedRestored intracellular replication

Production and Purification

Recombinant BsaZ is produced in E. coli with an N-terminal His tag for affinity chromatography :

ParameterDetail
Expression systemE. coli (BL21 or similar strains)
Purification methodNi-NTA column chromatography
Purity>90% (SDS-PAGE verified)
Storage bufferTris/PBS, 6% trehalose, pH 8.0
StabilityLyophilized powder stable at -80°C

The protein retains activity when reconstituted in deionized water, with glycerol (5–50%) recommended for long-term storage .

Mechanistic Studies

  • T3SS assembly: BsaZ is required for effector secretion, as shown by impaired BopE secretion in bsaZ mutants .

  • Host-pathogen interactions: Used to map vacuolar escape kinetics and actin tail formation in macrophages .

Drug Discovery

  • Antivirulence targets: BsaZ inhibition disrupts bacterial dissemination, making it a candidate for antivirulence therapies .

Vaccine Development

  • Antigen screening: Recombinant BsaZ aids in identifying immune-reactive epitopes for melioidosis vaccines .

Comparative Analysis with Orthologs

SpeciesFunctionVirulence Role
B. thailandensis BsaZDelayed vacuolar escape, cytokine inductionAttenuated in macrophages
B. pseudomallei BsaZEssential for early vacuolar escapeCritical for lethality
B. mallei BsaZStructural T3SS-3 componentRequired for hamster model

Homologs share >90% sequence identity, underscoring conserved roles in pathogenesis .

Technical Limitations and Solutions

  • Low solubility: Additives like arginine or glycerol improve refolding during purification .

  • Cross-reactivity: Anti-BsaZ antibodies may recognize orthologs; epitope tagging mitigates this .

Future Directions

  • Structural studies: Cryo-EM of BsaZ-T3SS complexes to resolve secretion mechanisms.

  • High-throughput screening: Leverage recombinant BsaZ to identify small-molecule inhibitors.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, kindly indicate it in your order remarks, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
bsaZ; BTH_II0839; Secretion apparatus protein BsaZ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-381
Protein Length
full length protein
Species
Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264)
Target Names
bsaZ
Target Protein Sequence
MAEKTEKPTAKKLRDAAKKGQTFKARDIVALVVIATGALSAPALVDLTRVAAEFTRIAST GAQPNPGAYALAWAKLFLRIAAPFVLLCAAVGALPSLVQSRFTLAVESIRFDLTALDPVK GMKRLFSWRSVKDAVKALLYVGVFAITVRVFADLYHHDVFGLFRARPALLGHMWIVLTVR LVLLFLLCALPVLIVDAAVEYFLYHRELKMDKHEVKQEYKESEGNHEIKSKRREIHQELL SEEIKANVEQSDFIVANPTHIAIGIYVNPDIVPIPFVSVRETNARALAVIRHAEACGVPV VRNVALARSIYRNSPRRYSFVNQDDIDGVMRVLIWLKEVEAANRGGPPREMPPEATHAPD AHGGDAASGGATSAQAGERNA
Uniprot No.

Target Background

Function
BsaZ, a component of the type III secretion system, plays a crucial role in the intracellular replication of invading bacteria within the host cell. It is likely essential for the lysis of the vacuole membrane and subsequent escape into the host cell cytoplasm.
Database Links
Protein Families
Type III secretion exporter family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of BsaZ in the Burkholderia Type 3 Secretion System?

BsaZ forms a key component of the inner membrane ring of the Burkholderia Secretion Apparatus (Bsa) Type 3 Secretion System (T3SS) and is required for a functional T3SS. It is homologous to YscU in Yersinia species and plays a critical structural role in the secretion machinery . The Bsa T3SS functions as a molecular syringe that injects bacterial effector proteins into host cells, where they manipulate cellular functions to benefit bacterial survival and replication .

Methodologically, studies investigating BsaZ function typically employ targeted mutagenesis approaches to generate bsaZ-null mutants, followed by comparative analyses of secretion profiles against wild-type strains. When examining protein secretion patterns, techniques such as Isobaric Tags for Relative and Absolute Quantification (iTRAQ) proteomics have proven valuable for identifying T3SS-dependent secreted proteins .

How does BsaZ contribute to Burkholderia pathogenesis?

BsaZ is essential for the functionality of the Bsa T3SS, which is critical for pathogenesis but in a stage-specific manner. While the T3SS is dispensable for bacterial invasion into host cells, it is absolutely required for escape from primary endosomes following internalization . This allows the bacteria to access the cytoplasm, where they can replicate and eventually spread to neighboring cells.

For research methodology, intracellular lifecycle assays comparing wild-type and bsaZ mutants are typically employed to assess endosomal escape efficiency. Microscopy-based approaches using fluorescent markers for endosomal compartments, combined with bacterial reporters, allow for precise temporal tracking of the escape process. Complementation studies where the bsaZ gene is reintroduced into mutant strains are essential to confirm phenotype specificity .

Why is Burkholderia thailandensis used as a model for studying BsaZ instead of more virulent species?

B. thailandensis serves as an excellent surrogate model for studying the more pathogenic B. pseudomallei and B. mallei for several practical and safety reasons. B. thailandensis requires only biosafety level 2 (BSL-2) containment, whereas the more virulent species require higher containment levels and are subject to Select Agent regulations that limit distribution and genetic manipulation .

Importantly, B. thailandensis expresses homologs of many virulence factors found in pathogenic Burkholderia species, including components of the Bsa T3SS such as BsaZ. The molecular mechanisms employed for host cell infection, intracellular survival, and cell-to-cell spread are largely conserved across these species .

When designing experiments with B. thailandensis as a model system, researchers should validate key findings through comparative analyses with pathogenic species when possible, or through literature-based confirmation that the molecular mechanisms being studied are conserved.

What are the most effective methods for generating recombinant BsaZ in B. thailandensis for functional studies?

For recombinant expression of BsaZ in B. thailandensis, the Mini-Tn7 transposon system has proven highly effective. This system allows for site-specific integration of the gene of interest into the bacterial genome at predetermined attachment sites downstream of glucosamine-6-phosphate synthetase genes (glmS1/2) .

The methodological approach includes:

  • Optimizing the gene sequence for expression in Burkholderia by adjusting the GC content (typically increased to ~63%) without altering the amino acid sequence

  • Placing the gene under the control of a constitutive promoter such as the ribosomal protein S12 gene promoter (Ps12)

  • Cloning the construct into a MiniTn7 vector (e.g., MiniTn7-kan)

  • Transformation into B. thailandensis through electroporation or conjugation

  • Selection of transformants using appropriate antibiotics

  • Verification of integration through PCR and expression validation via Western blotting

This approach ensures stable chromosomal integration and consistent expression levels, which are critical for reliable functional studies of BsaZ .

How can researchers effectively isolate and verify BsaZ-dependent secreted proteins?

To isolate and identify BsaZ-dependent secreted proteins, researchers should employ a comparative proteomics approach using wild-type bacteria and isogenic bsaZ mutants. The following methodology is recommended:

  • Culture bacteria in secretion-inducing conditions (typically minimal media or host cell-mimicking conditions)

  • Carefully separate bacterial cells from culture supernatants using centrifugation and filtration

  • Concentrate secreted proteins from supernatants using techniques such as TCA precipitation or ultrafiltration

  • Process samples for proteomics analysis using quantitative approaches such as iTRAQ

  • Compare protein abundance profiles between wild-type and bsaZ mutant strains

For verification of specific secreted proteins, construct hypersecreting mutants lacking regulatory components such as BsaP or BipD, which have been shown to enhance secretion of effector proteins like BopE . This approach significantly increases the sensitivity for detecting T3SS-dependent secreted proteins.

What controls are essential when assessing BsaZ function in endosomal escape assays?

When conducting endosomal escape assays to assess BsaZ function, several critical controls must be included:

  • Positive control: Wild-type B. thailandensis strain with documented escape capability

  • Negative control: A bsaZ-null mutant known to be defective in endosomal escape

  • Complementation control: The bsaZ mutant complemented with a functional bsaZ gene to restore wild-type phenotype

  • T3SS-independent control: A strain with mutations in other T3SS components to distinguish BsaZ-specific effects from general T3SS defects

  • Timing controls: Samples collected at multiple time points to track the kinetics of escape

  • Host cell viability controls: To ensure observed phenotypes are not due to cytotoxicity

For methodological rigor, incorporate both microscopy-based approaches (using endosomal markers and bacterial reporters) and biochemical fractionation techniques to confirm the subcellular localization of bacteria at different time points post-infection .

How does BsaZ coordinate with other secretion systems during different stages of Burkholderia infection?

BsaZ functions within a complex network of secretion systems that operate at different stages of infection. Research indicates that while the BsaZ-dependent T3SS is critical for endosomal escape, other systems like the Type 6 Secretion System (T6SS-1) function downstream and are essential for intercellular spread and plaque formation .

To methodologically investigate these interactions:

  • Generate single and combinatorial mutants lacking components of different secretion systems

  • Employ time-resolved infection assays to determine the temporal sequence of secretion system activation

  • Use nanoblade delivery techniques to bypass certain infection stages and isolate the role of specific secretion systems

  • Perform transcriptomic and proteomic analyses at different infection stages to identify co-regulation patterns

  • Use fluorescence reporters to visualize the localization and activation timing of different secretion apparatus components

This experimental approach has revealed that while the Bsa T3SS (including BsaZ) is dispensable for invasion, it is essential for primary endosome escape, after which T6SS-1 becomes critical for subsequent steps in the intracellular life cycle .

What structural modifications to recombinant BsaZ affect its assembly into the T3SS complex?

The structural integration of BsaZ into the T3SS complex is critical for function, and modifications can significantly impact assembly. Based on homology to YscU in Yersinia, BsaZ likely undergoes autocleavage necessary for proper T3SS function.

For investigating structural requirements:

  • Generate site-directed mutations at predicted functional domains, particularly at potential autocleavage sites

  • Create truncated variants to identify minimal functional domains

  • Introduce epitope tags at different positions to assess accessibility and complex formation

  • Employ bacterial two-hybrid or co-immunoprecipitation assays to map protein-protein interactions within the T3SS complex

  • Use super-resolution microscopy to visualize complex assembly with fluorescently-tagged components

When designing recombinant BsaZ constructs, researchers should carefully consider tag placement to avoid disrupting critical functional domains or protein-protein interaction interfaces within the secretion apparatus .

How do post-translational modifications affect BsaZ functionality in the context of host infection?

The role of post-translational modifications (PTMs) in regulating BsaZ function remains an underexplored area with significant implications for understanding T3SS regulation. To investigate this aspect:

  • Use mass spectrometry-based approaches to identify PTMs on BsaZ isolated from bacteria under different growth conditions and during host cell infection

  • Create site-directed mutants that mimic or prevent specific modifications (phosphomimetic or non-phosphorylatable residues)

  • Identify bacterial or host enzymes responsible for these modifications through pulldown assays and targeted inhibition

  • Compare modification patterns between hypervirulent and attenuated strains to identify correlations with pathogenicity

  • Develop temporal profiles of PTM acquisition during the infection process

This methodological approach can reveal how host-pathogen interactions influence T3SS function through direct modification of structural components like BsaZ, potentially identifying new targets for therapeutic intervention.

How does BsaZ from B. thailandensis differ functionally from its homologs in B. pseudomallei and B. mallei?

While BsaZ is highly conserved among Burkholderia species, subtle variations may contribute to differences in virulence and host adaptation. To systematically investigate these differences:

  • Perform comparative sequence and structural analyses of BsaZ across Burkholderia species

  • Generate chimeric proteins by swapping domains between species to identify regions responsible for functional differences

  • Complement bsaZ mutants of one species with the homolog from another species to assess functional conservation

  • Compare secretion profiles and effector translocation efficiency between species-specific BsaZ variants

  • Assess host range differences that might correlate with BsaZ sequence variations

What quantitative differences exist in the secretomes of wild-type versus BsaZ-deficient B. thailandensis strains?

Quantitative proteomic analysis has revealed significant differences in protein secretion between wild-type and BsaZ-deficient strains. A comprehensive study using iTRAQ identified approximately 1,171 proteins representing 21% of all coding sequences in the B. thailandensis genome .

The methodological approach for such analysis includes:

  • Careful preparation of bacterial culture supernatants

  • Protein concentration and digestion for mass spectrometry

  • iTRAQ labeling for quantitative comparison

  • LC-MS/MS analysis and database searching

  • Statistical analysis of differential protein abundance

Results typically show that BsaZ-deficient strains fail to secrete known T3SS effectors such as BopE and BipD. Additionally, comparing secretomes between hypersecreting mutants (e.g., those lacking BsaP or BipD) and BsaZ-deficient strains has identified at least 26 putative Bsa-dependent secreted proteins, providing valuable insights into the full repertoire of T3SS substrates .

How does the intracellular lifecycle of BsaZ-deficient B. thailandensis compare with other T3SS mutants?

The intracellular lifecycle of BsaZ-deficient B. thailandensis shows specific defects compared to other T3SS mutants. While all components of the T3SS are eventually necessary for successful infection, genetic dissection studies have identified distinct roles at different stages.

Methodologically, comparative analysis should include:

  • Time-course infection studies with various mutants

  • Microscopy-based tracking of intracellular bacteria

  • Cell-to-cell spread assays using plaque formation

  • Multinucleate giant cell (MNGC) formation assessment

  • Photothermal nanoblade delivery to bypass specific infection stages

Results from such studies have shown that BsaZ mutants can successfully invade host cells but remain trapped in endosomes, unlike wild-type bacteria that escape to the cytoplasm. This contrasts with mutants of other systems like T6SS-1, which can escape endosomes but fail in subsequent intercellular spread. The phenotypic analysis of these various mutants has revealed that cell fusion, rather than pseudopod engulfment, is the primary mechanism for intercellular spread of Burkholderia .

What strategies can resolve inconsistent expression of recombinant BsaZ in B. thailandensis?

Inconsistent expression of recombinant BsaZ can significantly impact experimental reproducibility. To address this challenge:

  • Optimize promoter selection: Compare constitutive promoters (such as Ps12) with inducible systems to identify the most stable expression platform

  • Codon optimization: Ensure the recombinant BsaZ gene is properly optimized for B. thailandensis by adjusting GC content to approximately 63% without altering the amino acid sequence

  • Integration site selection: While the attTn7 sites downstream of glmS1/2 genes are generally reliable, compare expression levels between these two chromosomal locations

  • Expression verification: Implement routine Western blot validation across experiments and batches

  • Growth condition standardization: Establish strictly standardized culture conditions as expression can vary with growth phase and environmental factors

When inconsistencies persist, consider using the BONCAT (bio-orthogonal noncanonical amino acid tagging) approach, which has been successfully applied to B. thailandensis and allows for selective labeling and enrichment of newly synthesized proteins under defined conditions .

How can researchers address contamination issues when isolating BsaZ-dependent secreted proteins?

Contamination with non-secreted proteins is a common challenge when isolating T3SS-dependent secreted proteins. To minimize this issue:

  • Optimize bacterial growth conditions: Use minimal media with appropriate supplements to reduce cell lysis

  • Implement strict fractionation protocols: Include multiple centrifugation steps at increasing speeds to remove all intact bacteria and cell debris

  • Verify sample purity: Perform Western blots for known cytoplasmic markers (e.g., RNA polymerase) to confirm the absence of cellular contamination

  • Use selective labeling approaches: Apply techniques like BONCAT, which allows selective labeling of newly synthesized bacterial proteins

  • Employ hypersecreting mutants: Utilize strains lacking regulatory components such as BsaP or BipD, which increase the signal-to-noise ratio for T3SS-dependent secreted proteins

  • Implement validation criteria: Establish strict criteria for considering a protein as genuinely secreted, such as enrichment in hypersecreting mutants and absence in T3SS-null mutants

These methodological refinements can substantially improve the reliability of secretome analyses and lead to more confident identification of BsaZ-dependent secreted proteins.

What statistical approaches are most appropriate for analyzing proteomic data from BsaZ secretion studies?

Quantitative proteomic analysis of BsaZ-dependent secretion requires robust statistical approaches to distinguish true differential secretion from technical variation. Based on published methodologies:

  • Replicate design: Include at least three biological replicates for each condition to enable meaningful statistical analysis

  • Normalization methods: Apply appropriate normalization to account for differences in total protein amounts between samples

  • Statistical testing: Implement both parametric (t-tests for normally distributed data) and non-parametric tests (for non-normal distributions)

  • Multiple testing correction: Apply false discovery rate (FDR) control using methods such as Benjamini-Hochberg procedure

  • Effect size thresholds: Establish minimum fold-change thresholds (typically 1.5-2 fold) combined with statistical significance

  • Correlation analysis: Evaluate consistency between biological replicates using correlation coefficients

Studies have shown remarkably good correlation between biological replicates in secretome analyses, even when the total number of spectra differed by more than two-fold between some replicates, highlighting the robustness of these approaches when properly implemented .

How should researchers interpret conflicting results between different experimental systems studying BsaZ function?

When faced with conflicting results regarding BsaZ function across different experimental systems, researchers should systematically evaluate several factors:

  • Strain differences: Verify if genetic background variations might explain functional differences

  • Methodological variations: Compare experimental protocols for key differences in culture conditions, infection parameters, or analytical techniques

  • Host cell factors: Consider if different host cell types used across studies might interact differently with the T3SS

  • Temporal considerations: Assess whether conflicting observations might represent different stages of a dynamic process

  • Complementation testing: Implement strict complementation controls to confirm phenotypes are specifically due to BsaZ

  • Cross-validation: Apply multiple independent techniques to verify key findings

When presenting such analyses, researchers should create comparative tables showing methodological differences and results across studies, helping to identify patterns that might explain discrepancies and guide future experimental design.

What emerging technologies could advance our understanding of BsaZ dynamics during infection?

Several cutting-edge technologies show promise for elucidating BsaZ dynamics during infection:

  • Cryo-electron tomography: To visualize the native structure of the T3SS in situ during different stages of assembly and activation

  • Live-cell super-resolution microscopy: To track the dynamics of fluorescently tagged BsaZ during the infection process

  • Proximity labeling approaches: Such as TurboID or APEX2 fused to BsaZ to identify transient interaction partners during infection

  • Single-cell proteomics: To understand cell-to-cell variability in T3SS activation and function

  • Photothermal nanoblade delivery: Already demonstrated for Burkholderia, this technique allows precise placement of bacteria directly into the cytoplasm, bypassing entry steps to isolate specific aspects of T3SS function

  • CRISPR interference systems: Adapted for use in Burkholderia to achieve tunable repression of bsaZ expression

  • Microfluidic infection models: To precisely control the microenvironment during infection and enable real-time imaging

These methodological advances could provide unprecedented insights into how BsaZ functions dynamically within the T3SS complex during host cell infection.

What are the key unanswered questions regarding BsaZ structure-function relationships?

Despite significant progress in understanding BsaZ's role in T3SS function, several critical questions about structure-function relationships remain unanswered:

  • Autocleavage mechanism: How does BsaZ autocleavage occur and how is it regulated during T3SS assembly?

  • Substrate recognition: What structural features of BsaZ contribute to the recognition and secretion of specific effector proteins?

  • Conformational changes: How does BsaZ structure change during the transition from secretion-inactive to secretion-active states?

  • Protein-protein interaction network: Which components of the T3SS directly interact with BsaZ and how do these interactions affect function?

  • Host factor interactions: Do host cellular factors directly interact with BsaZ to modulate T3SS function during infection?

Addressing these questions will require integrated structural biology approaches, including X-ray crystallography, cryo-EM, NMR, and computational modeling, combined with functional studies using site-directed mutagenesis and in vivo infection models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.