Recombinant Burkholderia thailandensis UPF0060 membrane protein BTH_I2792 (BTH_I2792)

Shipped with Ice Packs
In Stock

Description

Introduction

Burkholderia thailandensis is a Gram-negative bacterium commonly found in soil and water, known for its environmental adaptability and diverse metabolic capabilities . While generally considered an opportunistic pathogen, specific proteins within B. thailandensis contribute to its survival mechanisms and interactions with its environment . Among these proteins is the UPF0060 membrane protein BTH_I2792, which has been identified as a DedA family protein involved in colistin resistance .

General Information and Characteristics of BTH_I2792

BTH_I2792, also referred to as DbcA (DedA of Burkholderia required for colistin resistance), is a member of the DedA family of membrane proteins, which are highly conserved across various organisms . DedA proteins are integral membrane proteins that function as proton-dependent transporters .

Role in Colistin Resistance

BTH_I2792 plays a crucial role in the resistance of B. thailandensis to colistin, an antibiotic also known as polymyxin E . Colistin targets the lipopolysaccharide (LPS) lipid A component in the bacterial outer membrane . Resistance to colistin often involves modification of lipid A with the cationic sugar aminoarabinose (Ara4N), which reduces the binding affinity of colistin .

BTH_I2792 is essential for the proper modification of lipid A with Ara4N . Deletion of dbcA, the gene encoding BTH_I2792, results in reduced Ara4N modification of lipid A, leading to increased sensitivity to colistin .

Mechanism of Action

The mechanism by which BTH_I2792 influences lipid A modification involves maintaining optimal membrane potential at slightly alkaline pH . BTH_I2792 affects proton motive force (PMF)-dependent transporters, which are required for lipid A modification with Ara4N .

Overexpression of arn operons, which are involved in the biosynthesis and transport of lipid-linked Ara4N, can partially restore Ara4N modification of lipid A and colistin resistance in dbcA deletion mutants . Similarly, increasing the PMF by lowering the pH of the growth media can also enhance Ara4N modification and colistin resistance in these mutants .

BTH_I2792 also impacts sensitivity to bacitracin, and the expression of B. thailandensis UppP/BacA homologs can partially restore resistance to bacitracin .

Functional Analysis and Mutagenesis Studies

MutationEffect on Colistin ResistanceImpact on Growth
Wild type dbcAComplementation of growth in the presence of colistinNormal growth in the absence of colistin
D79AUnable to restore growth in the presence of colistin to the extent of wild type DbcANormal growth in the absence of colistin
R167AUnable to restore growth in the presence of colistin to the extent of wild type DbcANormal growth in the absence of colistin
E67AComplementation of growth in the presence of colistinNormal growth in the absence of colistin
R161AComplementation of growth in the presence of colistinNormal growth in the absence of colistin

Site-directed mutagenesis of conserved, charged amino acids in BTH_I2792 has revealed key residues involved in its transport mechanism . Specifically, D79 and R167 appear to play major roles, while E67 and R161 may have more minor roles .

Additional Functions

In addition to its role in antibiotic resistance, BTH_I2792 is involved in acid tolerance, with the products of arn operons being essential for survival under acidic conditions . BTH_I2792 also affects membrane potential and motility . Deletion of dbcA results in impaired motility and increased sensitivity to CCCP, a protonophore that disrupts membrane potential .

Heterologous Expression

B. thailandensis can be engineered to express complex specialized metabolites, making it a useful chassis for heterologous expression . An efficient heterologous expression system has been developed using B. thailandensis E264, where efflux pump genes are deleted and constitutive strong promoters are screened . This system has been used to express biosynthetic gene clusters (BGCs) from various organisms, such as disorazol from Sorangium cellulosum and rhizoxin from Burkholderia rhizoxinica .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs unless dry ice is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your preferred tag type for prioritized development.
Synonyms
BTH_I2792; UPF0060 membrane protein BTH_I2792
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264)
Target Names
BTH_I2792
Target Protein Sequence
MLSLAKIAALFVLTAVAEIVGCYLPWLVLKAGKPVWLLAPAALSLALFAWLLTLHPAAAA RTYAAYGGVYIAVALAWLRIVDGVPLSRWDAAGAALALAGMSVIALQPRG
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is BTH_I2792 and why is it significant in bacterial research?

BTH_I2792, also known as DbcA (DedA of Burkholderia required for colistin resistance), is a UPF0060 membrane protein identified in Burkholderia thailandensis. This protein is a member of the DedA family of membrane proteins, which are highly conserved across various organisms. DedA proteins function as proton-dependent transporters embedded in bacterial membranes. The significance of BTH_I2792 lies primarily in its critical role in antimicrobial resistance mechanisms, particularly against colistin (polymyxin E), a last-resort antibiotic for treating multidrug-resistant gram-negative bacterial infections. BTH_I2792 is essential for the proper modification of lipopolysaccharide lipid A with aminoarabinose (Ara4N), which reduces colistin binding affinity to bacterial outer membranes. Understanding this protein's function provides valuable insights into bacterial survival mechanisms and potential targets for novel antimicrobial strategies.

How does BTH_I2792 contribute to the survival mechanisms of B. thailandensis?

BTH_I2792 contributes to B. thailandensis survival through multiple mechanisms. Primarily, it facilitates resistance to colistin by enabling the modification of lipid A with aminoarabinose (Ara4N). This modification alters the charge properties of the bacterial outer membrane, reducing the binding affinity of cationic antimicrobial peptides like colistin. Additionally, BTH_I2792 plays an important role in acid tolerance, with the products of arn operons being essential for survival under acidic conditions. The protein also influences membrane potential and bacterial motility, with deletion of dbcA (the gene encoding BTH_I2792) resulting in impaired motility and increased sensitivity to membrane potential disruptors like CCCP (carbonyl cyanide m-chlorophenyl hydrazone). These multiple roles highlight how BTH_I2792 contributes to environmental adaptability and stress response in B. thailandensis, making it an important subject for understanding bacterial resilience mechanisms.

What research model systems are appropriate for studying BTH_I2792?

B. thailandensis serves as an excellent model organism for studying BTH_I2792 due to its genetic manipulability and non-pathogenic nature compared to related pathogenic species. For research purposes, B. thailandensis E264 is frequently used as it can be engineered to express complex specialized metabolites, making it a useful chassis for heterologous expression. When studying BTH_I2792 specifically, researchers often employ genetic manipulation techniques such as conjugation, natural transformation, mini-Tn7 insertion, and allelic exchange to generate mutants with altered or deleted dbcA genes . CTLL-2 mouse cytotoxic T cells can also be used in certain assays when evaluating membrane protein functions . For structural and functional studies of membrane proteins like BTH_I2792, recombinant expression systems involving E. coli have proven valuable, but careful consideration must be given to protein folding and membrane integration challenges when working with multi-spanning membrane proteins . The choice of model system should align with specific research questions, whether they focus on genetic analysis, protein structure, or functional characterization.

What genetic manipulation techniques are most effective for studying BTH_I2792 function?

Several genetic manipulation techniques have proven effective for studying BTH_I2792 function in B. thailandensis. Conjugation is a primary method that involves transferring plasmid DNA from a donor E. coli strain to B. thailandensis on non-selective media, followed by selection for transconjugants using appropriate antibiotics . This approach is particularly useful for introducing expression vectors or gene deletion constructs. Natural transformation provides another valuable technique, taking advantage of B. thailandensis' natural competence when cultured in minimal glucose medium . With this method, researchers can introduce linear DNA fragments with antibiotic resistance markers flanked by homologous regions to the target gene, facilitating targeted gene replacement.

For precise insertion of genetic elements at specific neutral sites, mini-Tn7 insertion has been widely utilized. This method allows stable integration of genetic constructs at a defined attTn7 site without disrupting essential genes . For generating unmarked mutations or precise genetic modifications in BTH_I2792, allelic exchange remains the gold standard. This two-step process involves: (1) integrating a suicide vector containing the desired mutation via homologous recombination, and (2) counter-selecting for plasmid loss using either sacB/sucrose or I-SceI endonuclease systems .

For marker removal after genetic modifications, FLP recombinase-mediated marker excision can be employed using a rhamnose-inducible flp contained on a temperature-sensitive plasmid (pFlpe4 or pFlpTet), allowing multiple sequential genetic manipulations . Each technique offers distinct advantages depending on the specific research objective, with allelic exchange providing the highest precision for studying specific amino acid residues in BTH_I2792.

How should site-directed mutagenesis be designed to investigate key functional residues in BTH_I2792?

Site-directed mutagenesis for investigating BTH_I2792 should be strategically designed based on sequence conservation analysis and structural predictions of this DedA family protein. Previous studies have identified critical charged amino acids that are essential for BTH_I2792 function, particularly D79 and R167, which play major roles in the transport mechanism, while E67 and R161 appear to have more minor roles. When designing mutagenesis experiments, researchers should:

  • Target conserved, charged residues for alanine substitution, as these are often critical for proton-dependent transport functions.

  • Consider the following mutations based on previous findings:

MutationEffect on Colistin ResistanceImpact on GrowthFunctional Significance
Wild type dbcAComplementation of growth in the presence of colistinNormal growth in the absence of colistinReference control
D79AUnable to restore growth in the presence of colistinNormal growth without colistinCritical for transport function
R167AUnable to restore growth in the presence of colistinNormal growth without colistinCritical for transport function
E67AComplementation of growth in colistinNormal growth without colistinMinor functional role
R161AComplementation of growth in colistinNormal growth without colistinMinor functional role
  • Use allelic exchange techniques for introducing mutations, employing a suicide vector like pEXKm5 containing homology regions that flank the mutation site .

  • Develop functional assays to assess the impact of mutations, including colistin susceptibility testing, measurements of membrane potential, and lipid A modification analysis.

  • Consider double mutants to investigate potential functional interactions between residues.

Each mutation should be validated through complementation studies, where wild-type BTH_I2792 is reintroduced to confirm that the observed phenotypes are specifically due to the targeted mutation rather than polar effects or secondary mutations.

What expression systems and purification strategies are recommended for obtaining functional recombinant BTH_I2792?

Expressing and purifying functional multi-spanning membrane proteins like BTH_I2792 presents significant challenges that require careful consideration of expression systems and purification strategies. For optimal results, the following methodological approach is recommended:

Expression Systems:

  • E. coli-based expression systems with specialized strains like C41(DE3) or C43(DE3) that are adapted for membrane protein expression can be utilized for initial attempts . These strains minimize toxicity associated with membrane protein overexpression.

  • For more complex expression needs, consider using B. thailandensis E264 with constitutive strong promoters, particularly when native folding and post-translational modifications are critical.

  • Use expression vectors with inducible promoters (such as T7 or rhamnose-inducible) to control expression levels and timing, which is crucial for proper membrane protein folding.

Purification Strategies:

  • Employ a two-step solubilization process: first with mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) to extract BTH_I2792 from membranes while preserving protein structure.

  • Utilize affinity chromatography with carefully positioned tags (preferably C-terminal His6 tags to avoid interference with membrane insertion) for initial purification.

  • Follow with size exclusion chromatography to separate properly folded protein from aggregates.

  • Consider incorporating stabilizing agents during purification, such as specific lipids that might be required for BTH_I2792 function.

  • For functional studies, reconstitution into proteoliposomes or nanodiscs may be necessary to maintain native-like membrane environments.

When assessing protein quality, employ multiple validation techniques including circular dichroism to evaluate secondary structure content, dynamic light scattering to detect aggregation, and functional assays measuring proton transport capability to confirm that the purified protein retains its native activity. Throughout the process, it's critical to maintain the protein's membrane environment as much as possible, as BTH_I2792's function is intrinsically linked to its membrane topology and lipid interactions.

How does BTH_I2792 influence lipid A modification and what experimental approaches best demonstrate this relationship?

BTH_I2792 plays a crucial role in lipid A modification with aminoarabinose (Ara4N), which is essential for colistin resistance in B. thailandensis. The mechanism involves maintaining optimal membrane potential, particularly at slightly alkaline pH, which affects proton motive force (PMF)-dependent transporters required for lipid A modification. To experimentally demonstrate and investigate this relationship, researchers should employ a multi-faceted approach:

  • Lipid A Analysis: Extract and analyze lipid A using mass spectrometry techniques to quantify Ara4N modification levels in wild-type B. thailandensis compared to dbcA deletion mutants. This directly demonstrates the impact of BTH_I2792 on lipid A structure.

  • Membrane Potential Measurements: Utilize fluorescent probes like DiSC3(5) or TMRM to measure membrane potential in wild-type and mutant strains. This establishes the link between BTH_I2792 and membrane energetics.

  • pH-Dependent Functional Assays: Assess colistin resistance across a range of pH values (6.5-8.0) in both wild-type and mutant strains. Previous research has shown that increasing the PMF by lowering pH can partially restore Ara4N modification and colistin resistance in dbcA deletion mutants.

  • Gene Expression Analysis: Measure expression levels of arn operons (involved in Ara4N biosynthesis and transport) in response to BTH_I2792 presence/absence. Overexpression of arn operons can partially restore Ara4N modification and colistin resistance in deletion mutants.

  • Protein-Protein Interaction Studies: Investigate potential interactions between BTH_I2792 and components of the Ara4N modification machinery using techniques like bacterial two-hybrid assays or co-immunoprecipitation.

This comprehensive approach not only establishes the functional relationship between BTH_I2792 and lipid A modification but also elucidates the underlying mechanisms involving membrane potential, proton gradients, and their impact on antimicrobial resistance phenotypes.

What role does BTH_I2792 play in membrane protein folding and topogenesis?

While the search results don't directly address BTH_I2792's role in membrane protein folding and topogenesis, understanding its function can be informed by broader research on multi-spanning membrane proteins. As a DedA family protein with multiple transmembrane domains, BTH_I2792 likely undergoes complex folding processes similar to those described for other multi-spanning membrane proteins .

Recent research indicates that many multi-spanning membrane proteins contain poorly hydrophobic transmembrane domains (pTMDs) that are difficult for translocons to recognize and insert. These pTMDs often elicit post-translational topogenesis pathways for their recognition and integration . In the case of proteins like six-spanning ABCG2, pTMDs can initially pass through the translocon into the endoplasmic reticulum lumen, yielding intermediates with inserted yet mis-oriented downstream TMDs .

For BTH_I2792 specifically, its proper folding and topogenesis likely require:

  • Coordinated co-translational insertion of highly hydrophobic TMDs

  • Potential post-translational reorientation of less hydrophobic segments

  • Assistance from membrane protein chaperones, possibly including ATP13A1-like P5A-ATPases that facilitate TMD re-orientation

  • Final folding steps that bury pTMDs into the correct structure to avoid excessive lipid exposure

These processes would be critical for BTH_I2792 to achieve its functional conformation, allowing it to influence membrane potential and participate in colistin resistance mechanisms. Experimental approaches to study its folding might include pulse-chase analysis combined with protease protection assays, crosslinking studies to capture folding intermediates, and analysis of BTH_I2792 variants with mutations in potential pTMDs to identify critical regions for proper membrane integration.

How does the proton motive force mechanism of BTH_I2792 differ from other membrane transporters?

BTH_I2792, as a DedA family membrane protein, functions as a proton-dependent transporter with distinctive characteristics compared to other transporter classes. While the search results don't provide a direct comparison, we can infer several differences based on BTH_I2792's functional properties:

First, BTH_I2792 appears to maintain optimal membrane potential, particularly at slightly alkaline pH, which influences PMF-dependent transporters required for lipid A modification with Ara4N. This suggests BTH_I2792 may function as a regulator of membrane energetics rather than a direct transporter of specific substrates, distinguishing it from classical transporters like ABC transporters or secondary active transporters.

Second, the functional importance of charged residues D79 and R167 (and to a lesser extent, E67 and R161) indicates a proton relay mechanism possibly different from the proton coupling mechanisms in transporters like Major Facilitator Superfamily (MFS) proteins. The spatial arrangement of these residues likely creates a unique proton pathway that influences membrane potential.

Third, unlike many PMF-dependent transporters that directly couple substrate movement to proton gradients in fixed stoichiometry, BTH_I2792 seems to have a more indirect effect on cellular processes through its impact on membrane energetics. This is evidenced by its broad effects on colistin resistance, acid tolerance, and bacterial motility.

To experimentally distinguish BTH_I2792's PMF mechanism from other transporters, researchers should:

  • Conduct proton transport assays using reconstituted proteoliposomes containing purified BTH_I2792

  • Perform electrophysiological studies to measure ion conductance and selectivity

  • Determine the effect of protonophores and pH gradients on BTH_I2792 function

  • Map the complete proton transfer pathway through systematic mutagenesis of charged and polar residues

These approaches would help elucidate the unique features of BTH_I2792's proton motive force mechanism and its distinctive role in bacterial physiology.

How can BTH_I2792 research contribute to developing novel antimicrobial strategies?

Research on BTH_I2792 offers several promising avenues for developing novel antimicrobial strategies, particularly against resistant Gram-negative pathogens. Since BTH_I2792 is crucial for colistin resistance in B. thailandensis (a model for more pathogenic Burkholderia species), understanding its mechanism provides potential targets for antimicrobial development.

First, inhibitors targeting BTH_I2792 could serve as adjuvants to restore colistin sensitivity in resistant bacteria. The identification of key functional residues (D79 and R167) provides specific molecular targets for rational drug design. Compounds disrupting the proton-dependent transport function of BTH_I2792 would compromise bacterial resistance mechanisms while not being directly antimicrobial themselves, potentially reducing selective pressure for resistance development.

Second, the role of BTH_I2792 in maintaining membrane potential suggests that its inhibition could synergize with other antibiotics whose efficacy depends on membrane energetics, such as aminoglycosides. Experimental approaches to explore this include:

  • High-throughput screening for small molecule inhibitors of BTH_I2792 using bacterial systems with reporter genes linked to colistin resistance

  • Structure-based drug design targeting the identified critical residues

  • Combination therapy testing to identify synergistic effects between BTH_I2792 inhibitors and existing antibiotics

  • In vivo efficacy studies in appropriate infection models

Third, understanding the fundamental biology of DedA family proteins through BTH_I2792 research could reveal conserved vulnerability points across multiple bacterial pathogens, as these proteins are widely distributed and often essential. The relationship between BTH_I2792 and Ara4N modification pathways also suggests that targeting this interaction could provide an alternative approach to overcoming antimicrobial resistance mechanisms based on lipopolysaccharide modifications.

What experimental approaches are most effective for resolving contradictory data in BTH_I2792 research?

When faced with contradictory data in BTH_I2792 research, researchers should implement a systematic approach to resolve discrepancies through rigorous experimental design and comprehensive analysis. The following methodological framework is recommended:

  • Strain Verification and Standardization: Confirm the genetic background of all B. thailandensis strains used, as mutations in other genes could influence BTH_I2792-related phenotypes. Whole-genome sequencing can identify unintended mutations. Standardize growth conditions, media composition, and assay protocols across experiments to minimize variability.

  • Multiple Complementary Techniques: Apply diverse methodological approaches to address the same question. For instance, when studying colistin resistance mechanisms, combine:

    • Minimum inhibitory concentration (MIC) determinations

    • Time-kill assays

    • Microscopy to assess membrane integrity

    • Lipid A structural analysis

    • Gene expression profiling

  • Genetic Validation: Employ both loss-of-function and gain-of-function approaches:

    • Generate clean deletion mutants using allelic exchange

    • Create point mutations in key residues (D79, R167, E67, R161)

    • Perform complementation studies with wild-type BTH_I2792

    • Use inducible expression systems to examine dose-dependent effects

  • Collaborative Cross-Validation: Engage multiple laboratories to independently replicate key experiments under standardized conditions, particularly when contradictory results emerge.

  • Context-Dependent Analysis: Systematically vary experimental conditions (pH, temperature, growth phase, media composition) to determine if contradictions arise from context-dependent functions of BTH_I2792. Previous research has shown that pH influences BTH_I2792's role in Ara4N modification and colistin resistance.

  • Quantitative Systems Approach: Develop mathematical models integrating membrane potential, proton gradients, and lipid A modification to predict BTH_I2792 function under various conditions, then test model predictions experimentally.

This comprehensive approach not only resolves contradictions but often leads to deeper insights into the multifunctional nature of proteins like BTH_I2792 and how their activities are modulated by environmental conditions.

How might BTH_I2792 research inform structural studies of other DedA family proteins across bacterial species?

Research on BTH_I2792 provides a valuable foundation for structural studies of DedA family proteins across diverse bacterial species. These proteins are highly conserved and present in most bacteria, yet their structural characteristics remain poorly understood. BTH_I2792 research offers several methodological approaches that can be applied to the broader DedA family:

First, the identification of functionally critical residues in BTH_I2792 (D79, R167, E67, R161) provides specific targets for structure-function analysis in homologous proteins. These conserved charged residues likely form essential components of the proton relay pathway, and their spatial arrangement would be a priority focus in structural studies. Researchers can use this information to guide site-directed mutagenesis experiments in other DedA family members, testing whether functional roles are conserved.

Second, the relationship between BTH_I2792 and membrane potential suggests that DedA proteins may share a common mechanism involving proton transport and membrane energetics. This functional insight informs structural studies by highlighting the importance of capturing these proteins in different conformational states that might represent distinct steps in the proton transport cycle.

Third, the techniques developed for expressing and purifying recombinant BTH_I2792 can be optimized for other DedA family members. Given the challenges of membrane protein structural biology, successful approaches with BTH_I2792 provide valuable protocols that can be adapted for homologs.

To systematically apply BTH_I2792 research to structural studies of the DedA family:

  • Conduct comprehensive sequence analysis across bacterial species to identify highly conserved regions beyond the known functional residues

  • Use BTH_I2792 as a template for homology modeling of other DedA proteins

  • Apply successful expression and purification strategies from BTH_I2792 to selected DedA homologs

  • Prioritize crystallization or cryo-EM studies on the most stable DedA family members

  • Develop common functional assays based on proton transport capabilities

This approach would leverage BTH_I2792 research to accelerate structural understanding across the entire DedA protein family, potentially revealing common mechanisms and species-specific adaptations.

What are the optimal storage and handling conditions for recombinant BTH_I2792 to maintain stability and activity?

Maintaining the stability and activity of recombinant membrane proteins like BTH_I2792 requires careful attention to storage and handling conditions. Based on general principles for membrane protein handling and specific information from the search results, the following protocol is recommended:

For lyophilized recombinant protein preparations:

  • Store the lyophilized protein at -20°C in a manual defrost freezer to prevent degradation .

  • When reconstituting, use sterile deionized water to reach a concentration of approximately 500 μg/mL .

  • After reconstitution, the protein should be used immediately or aliquoted and stored at -80°C.

  • Avoid repeated freeze-thaw cycles as these can significantly compromise membrane protein integrity .

For liquid formulations:

  • The protein should be supplied as a 0.2 μm filtered solution in an appropriate buffer (such as sodium acetate) that maintains protein stability .

  • Ship with dry ice or equivalent cooling method to prevent denaturation .

  • Upon receipt, immediately store at -80°C in a manual defrost freezer .

  • When thawing for use, place on ice and use within the same day if possible.

For working with the protein in experiments:

  • Maintain the protein in appropriate detergent micelles or lipid environments to preserve native structure.

  • Keep solutions cold (4°C) during handling to minimize degradation.

  • Consider adding protease inhibitors when working with the protein for extended periods.

  • When performing functional assays, control pH carefully, as BTH_I2792 function is known to be pH-dependent.

Activity can be validated using membrane potential assays or reconstitution into proteoliposomes to measure proton transport capability. For long-term research projects, it's advisable to characterize each new batch of recombinant BTH_I2792 to ensure consistent activity before use in critical experiments.

What control experiments are essential when investigating BTH_I2792 function in colistin resistance?

  • Genetic Complementation Controls:

    • Negative control: B. thailandensis with dbcA deletion

    • Positive control: dbcA deletion strain complemented with wild-type BTH_I2792

    • Vector-only control: dbcA deletion with empty expression vector

    • Site-directed mutant controls: complementation with BTH_I2792 containing mutations in key residues (D79A, R167A, E67A, R161A)

  • Antimicrobial Susceptibility Controls:

    • Range of colistin concentrations to establish complete MIC profiles

    • Testing alternative antimicrobials (e.g., bacitracin) to determine specificity of BTH_I2792's effect

    • Growth curves in the absence of antimicrobials to rule out general growth defects

    • Colistin susceptibility testing at different pH values, as BTH_I2792 function is pH-dependent

  • Lipid A Modification Controls:

    • Analysis of lipid A from wild-type and mutant strains grown under identical conditions

    • Comparison of lipid A profiles with and without colistin exposure

    • Controls for extraction efficiency and sample processing

    • Quantification of Ara4N modification levels across multiple biological replicates

  • Membrane Potential Controls:

    • Baseline membrane potential measurements in wild-type and mutant strains

    • Positive controls using known protonophores like CCCP

    • Measurements at different pH values to establish pH-dependence

    • Time-course measurements to capture dynamic changes

  • Gene Expression Controls:

    • Expression analysis of BTH_I2792 in all strains to confirm deletion/complementation

    • Monitoring expression of arn operon genes to assess potential compensatory responses

    • Housekeeping gene controls for normalization

    • Temporal expression analysis during exposure to sub-inhibitory colistin concentrations

What interdisciplinary approaches can advance our understanding of BTH_I2792 and related membrane proteins?

Advancing our understanding of BTH_I2792 and related membrane proteins requires innovative interdisciplinary approaches that integrate diverse scientific methodologies. The following research strategies combine techniques from multiple disciplines to address complex questions about membrane protein structure, function, and biological significance:

  • Structural Biology and Biophysics Integration:

    • Cryo-electron microscopy combined with molecular dynamics simulations to elucidate BTH_I2792's structure in different conformational states

    • Solid-state NMR spectroscopy to investigate dynamics of specific residues within the membrane environment

    • Hydrogen-deuterium exchange mass spectrometry to identify regions involved in conformational changes

    • Single-molecule FRET studies to monitor real-time structural transitions during proton transport

  • Systems Biology and Genetic Approaches:

    • Global genetic interaction mapping (synthetic genetic arrays) to identify functional relationships between BTH_I2792 and other cellular components

    • Transcriptomics and proteomics analysis of BTH_I2792 mutants under various stress conditions

    • Metabolomics profiling to detect changes in cellular metabolism related to membrane energetics

    • Genome-wide CRISPR screens to identify genes that modify BTH_I2792-dependent phenotypes

  • Chemical Biology and Pharmacology:

    • Development of chemical probes that specifically target BTH_I2792

    • Photoaffinity labeling to map binding sites of potential inhibitors

    • Fragment-based drug discovery approaches to identify chemical scaffolds for modulating BTH_I2792 function

    • High-throughput screening for compounds that synergize with colistin in BTH_I2792-expressing bacteria

  • Computational and Artificial Intelligence Methods:

    • Machine learning algorithms to predict structural features from sequence data across the DedA family

    • Quantum mechanics/molecular mechanics (QM/MM) simulations to model proton transfer mechanisms

    • Network analysis of protein-protein interactions to place BTH_I2792 in broader cellular contexts

    • In silico screening of compound libraries for potential BTH_I2792 modulators

  • Evolutionary and Comparative Biology:

    • Phylogenetic analysis of DedA proteins across bacterial species to trace functional divergence

    • Experimental evolution studies under colistin selection to identify adaptive changes in BTH_I2792

    • Comparative analysis of DedA proteins in antibiotic-resistant clinical isolates

By integrating these interdisciplinary approaches, researchers can develop a comprehensive understanding of BTH_I2792 that spans from atomic-level structural details to ecosystem-level impacts on bacterial communities and antibiotic resistance. This holistic perspective is essential for translating basic knowledge about BTH_I2792 into practical applications in antimicrobial development and resistance management.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.