Recombinant Burkholderia vietnamiensis 4-hydroxybenzoate octaprenyltransferase (ubiA)

What is the biological function of 4-hydroxybenzoate octaprenyltransferase (UbiA) in Burkholderia vietnamiensis?

UbiA in Burkholderia vietnamiensis functions as a critical enzyme in the ubiquinone biosynthesis pathway. Specifically, it catalyzes the conversion of 4-hydroxybenzoate into 3-octaprenyl-4-hydroxybenzoate, which represents an essential step in ubiquinone production. This enzymatic activity directly impacts the bacterium's respiratory chain and electron transport system. The UbiA enzyme is membrane-bound, requiring Mg²⁺ for optimal catalytic activity, and its absence in ubiA⁻ mutants leads to ubiquinone deficiency . In the context of B. vietnamiensis, this enzyme contributes to the organism's unique metabolic characteristics that distinguish it from other members of the Burkholderia cepacia complex (BCC) .

How does the UbiA protein structure relate to its function in B. vietnamiensis?

The UbiA protein from B. vietnamiensis is a full-length protein consisting of 290 amino acids. Its structural features include multiple transmembrane domains reflected in its amino acid sequence (MLARFPLYLRLVRMDKPIGSLLLLWPTLNALWIASDGRPRWPLVAIFALGTLLMRSAGCA MNDYADRDFDRHVKRTADRPLTSGKIRAWEAVAIAAVLSFVAFLLILPLNTLTKELSVVA LFVAGSYPFMKRFFAIPQAYLGIAFGFGIPMAFAAVQGTVPALAWVMLVANVFWSVAYDT EYAMVDRDDDIKIGIRTSALTFGRFDVAAIMLCYAVTLGIYAWIGATLGFGLAFWAGWAA ALGCALYHYTLIKDRERMPCFAAFRHNNWLGGVLFAGIAAHYLVAGAAGN) . These hydrophobic regions facilitate its integration into the bacterial membrane, which is essential for its prenyltransferase activity. The membrane localization of UbiA is directly linked to its function, as both the side-chain precursor and the enzyme itself have been demonstrated to be membrane-bound in related bacterial systems . The enzyme's structure includes specific domains for binding 4-hydroxybenzoate and prenyl side chains, with conserved regions that are critical for substrate recognition and catalytic activity.

How does B. vietnamiensis UbiA compare to homologous proteins in other bacterial species?

While the fundamental enzymatic function remains conserved across species (converting 4-hydroxybenzoate to 3-octaprenyl-4-hydroxybenzoate), subtle variations in the protein sequence likely contribute to differences in substrate specificity, membrane interaction, and regulation. These variations may be particularly relevant when considering B. vietnamiensis's distinct physiological characteristics, including its intrinsic susceptibility to aminoglycosides despite resistance to other cationic antimicrobial agents .

What are the optimal conditions for recombinant expression of B. vietnamiensis UbiA protein?

The optimal expression of recombinant B. vietnamiensis UbiA protein has been achieved using E. coli as an expression host . Based on available research data, the following methodological approach is recommended:

• Expression system selection: E. coli provides an efficient platform for UbiA expression, particularly when the protein is fused with an N-terminal His-tag to facilitate purification .

• Vector design: The full-length UbiA gene (encoding amino acids 1-290) should be cloned into an appropriate expression vector with a strong promoter system compatible with E. coli.

• Expression conditions: Optimal expression typically requires induction at mid-logarithmic phase (OD₆₀₀ of 0.6-0.8), with IPTG concentrations between 0.1-1.0 mM. Lower temperatures during induction (16-25°C) may enhance proper folding of this membrane-associated protein.

• Growth media optimization: Enriched media such as Terrific Broth or 2xYT often provide better yields for membrane proteins compared to standard LB media.

• Expression verification: Western blotting with anti-His antibodies provides confirmation of successful expression, with the expected molecular weight of approximately 32-35 kDa (including the His-tag) .

When optimizing expression, researchers should monitor both total protein yield and functional activity, as high-level expression of membrane proteins can sometimes lead to inclusion body formation requiring refolding procedures.

What purification strategy yields the highest purity and activity for recombinant B. vietnamiensis UbiA?

A multi-step purification strategy is recommended to obtain high-purity, functionally active B. vietnamiensis UbiA:

• Initial membrane fraction isolation: Since UbiA is membrane-bound, isolation of the membrane fraction via differential centrifugation is a critical first step.

• Membrane protein solubilization: Gentle detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) at concentrations just above their critical micelle concentration effectively solubilize UbiA while preserving its activity.

• Immobilized metal affinity chromatography (IMAC): The His-tagged protein can be purified using Ni-NTA or similar matrices, with careful optimization of imidazole concentrations in washing and elution buffers to minimize non-specific binding while maximizing target protein recovery .

• Buffer composition: Throughout purification, maintaining buffer conditions that include Mg²⁺ (typically 5-10 mM) is essential, as the enzyme requires this divalent cation for optimal activity .

• Final polishing step: Size exclusion chromatography can serve as a final purification step to achieve >90% purity .

• Storage conditions: The purified protein is typically stored in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, with addition of 5-50% glycerol recommended for long-term storage at -20°C/-80°C .

This approach has demonstrated success in yielding UbiA preparations with purity greater than 90% as determined by SDS-PAGE .

How can researchers confirm the structural integrity and functional activity of purified UbiA?

Confirming both structural integrity and functional activity of purified UbiA requires a multi-faceted approach:

Structural integrity assessment:

• SDS-PAGE analysis: Reveals a single band at approximately 32-35 kDa (including His-tag), confirming size integrity .

• Western blotting: Using anti-His antibodies provides verification of the recombinant protein's identity .

• Circular dichroism (CD) spectroscopy: Offers insights into secondary structure composition, particularly important for membrane proteins.

• Thermal shift assays: Evaluates protein stability under various buffer conditions.

Functional activity verification:

• Enzymatic activity assay: Measure the conversion of 4-hydroxybenzoate to 3-octaprenyl-4-hydroxybenzoate in the presence of the prenyl donor (octaprenyl pyrophosphate) and Mg²⁺. This can be monitored by:

  • HPLC analysis of reaction products

  • Radioisotope-based assays using ¹⁴C-labeled substrates

  • Coupled enzyme assays measuring pyrophosphate release

• Membrane binding assessment: Liposome association assays can confirm the protein's ability to interact with membrane structures, an essential aspect of its native function .

• Complementation studies: Expression of the recombinant UbiA in UbiA-deficient bacterial strains should restore ubiquinone biosynthesis, providing functional validation in a biological context .

These combined approaches provide comprehensive validation of both structural and functional integrity of the purified UbiA protein.

How can researchers investigate the relationship between UbiA activity and aminoglycoside susceptibility in B. vietnamiensis?

To investigate the relationship between UbiA activity and aminoglycoside susceptibility in B. vietnamiensis, researchers can employ several methodological approaches:

• Gene knockout and complementation studies:

  • Generate ubiA deletion mutants in B. vietnamiensis using targeted mutagenesis techniques.

  • Evaluate aminoglycoside susceptibility patterns (MIC determination) in wild-type, ΔubiA mutants, and complemented strains.

  • Compare results with susceptibility to other antimicrobial agents, particularly cationic antimicrobial peptides and polymyxin B .

• Correlation analysis of UbiA expression and antibiotic resistance:

  • Quantify UbiA expression levels using RT-qPCR or proteomics approaches in:
    a) Environmental vs. clinical isolates
    b) Sequential clinical isolates from chronic infections
    c) Isolates with varying aminoglycoside susceptibility profiles

• Antibiotic accumulation studies:

  • Measure aminoglycoside accumulation in bacterial cells with different UbiA expression levels.

  • Compare with data showing that susceptible B. vietnamiensis isolates accumulate 5-6 times more gentamicin than resistant isolates .

• Membrane composition analysis:

  • Characterize lipopolysaccharide structures in relation to UbiA activity.

  • Investigate the presence of lipid A-associated 4-amino-4-deoxy-L-arabinose residues, which contribute to antimicrobial peptide resistance .

• Efflux pump inhibition studies:

  • Test aminoglycoside susceptibility in the presence of efflux pump inhibitors.

  • Investigate potential interactions between UbiA function and resistance-nodulation-division (RND) transporters .

This multi-faceted approach would provide comprehensive insights into how UbiA activity might influence aminoglycoside susceptibility in B. vietnamiensis, potentially revealing new therapeutic targets.

What role does UbiA play in the pathogenesis of B. vietnamiensis in cystic fibrosis infections?

Investigating UbiA's role in B. vietnamiensis pathogenesis during cystic fibrosis (CF) infections requires examining multiple aspects of host-pathogen interactions:

• Adaptive changes during chronic infection:

  • Compare UbiA sequence and expression levels between environmental isolates and sequential isolates from CF patients.

  • Data indicates that B. vietnamiensis strains acquire aminoglycoside resistance during chronic CF infection, which could be linked to UbiA-related changes .

• Stress response and persistence mechanisms:

  • Evaluate how UbiA activity affects bacterial survival under conditions mimicking the CF lung environment:
    a) Nutrient limitation
    b) Oxidative stress
    c) Antibiotic pressure (particularly tobramycin and azithromycin)
    d) Polymicrobial interactions

• Biofilm formation analysis:

  • Assess the impact of UbiA expression levels on biofilm development.

  • Compare biofilm formation in wild-type and UbiA-modulated strains.

  • Examine biofilm susceptibility to antimicrobials in relation to UbiA activity.

• Respiratory chain function:

  • Since UbiA is crucial for ubiquinone biosynthesis, investigate how variations in UbiA activity affect:
    a) Bacterial metabolism in microaerobic CF lung conditions
    b) Energy production under antimicrobial stress
    c) Persister cell formation

• Immune evasion mechanisms:

  • Study how UbiA-dependent changes in membrane composition might affect recognition by host immune components.

  • Investigate potential correlations between UbiA activity and resistance to host antimicrobial peptides.

This comprehensive research approach would clarify the significance of UbiA in B. vietnamiensis adaptation during CF infections and potentially identify new therapeutic strategies for these challenging infections.

How do mutations in the UbiA gene affect the biochemical properties and function of the enzyme?

Investigating the impact of UbiA mutations on enzyme function requires systematic structure-function analysis:

• Mutational analysis approach:

  • Generate site-directed mutations targeting:
    a) Conserved catalytic residues
    b) Substrate binding sites
    c) Membrane-interaction domains
    d) Naturally occurring variants identified in clinical isolates

• Biochemical characterization of mutant enzymes:

  • Determine kinetic parameters (Km, Vmax, kcat) for various mutants compared to wild-type.

  • Evaluate substrate specificity alterations, particularly regarding:
    a) Aromatic substrate preference (4-hydroxybenzoate vs. alternative substrates)
    b) Prenyl donor chain length specificity

  • Assess Mg²⁺ dependency and potential alterations in metal ion requirements .

• Membrane association analysis:

  • Compare membrane localization patterns of wild-type and mutant UbiA proteins.

  • Investigate if specific mutations alter the enzyme's interaction with bacterial membranes.

• Thermal and chemical stability assessment:

  • Examine how mutations affect protein stability under various conditions.

  • Determine if stability changes correlate with functional alterations.

• Structural implications:

  • Conduct computational modeling to predict how specific mutations impact protein folding and active site architecture.

  • If possible, obtain structural data (X-ray crystallography or cryo-EM) on wild-type and key mutant variants.

• Functional complementation studies:

  • Test the ability of various UbiA mutants to restore ubiquinone biosynthesis in UbiA-deficient strains.

  • Correlate biochemical changes with in vivo functional outcomes.

This systematic approach would provide valuable insights into structure-function relationships in UbiA and possibly identify critical residues for enzyme function that could serve as targets for inhibitor design.

What are the common challenges in maintaining protein stability during recombinant UbiA purification?

Researchers frequently encounter several stability challenges when purifying recombinant UbiA protein:

• Membrane protein solubilization complications:

  • Challenge: UbiA, being membrane-bound, often aggregates during extraction from membranes.

  • Solution: Optimize detergent type, concentration, and extraction conditions. Success has been reported using mild detergents like DDM or LDAO at concentrations just above CMC, with extraction performed at 4°C for 1-2 hours with gentle agitation.

• Protein precipitation during buffer exchanges:

  • Challenge: UbiA may precipitate during dialysis or concentration steps.

  • Solution: Include stabilizing agents such as trehalose (6%) in all buffers . Perform concentration steps at 4°C with frequent mixing to prevent concentration gradients at membrane surfaces.

• Activity loss during purification:

  • Challenge: Significant reduction in enzymatic activity despite protein recovery.

  • Solution: Maintain Mg²⁺ (5-10 mM) throughout all purification steps . Consider adding reducing agents like DTT (1-2 mM) to prevent oxidation of critical cysteine residues.

• Storage instability:

  • Challenge: Activity loss during freeze-thaw cycles.

  • Solution: Add glycerol (5-50%, with 50% being optimal) before aliquoting and freezing . Avoid repeated freeze-thaw cycles by preparing single-use aliquots.

• Heterogeneity in purified preparations:

  • Challenge: Multiple bands or forms observed despite high-purity protocols.

  • Solution: Include a final size-exclusion chromatography step to separate monomeric protein from aggregates or degradation products. Verify homogeneity using dynamic light scattering as well as SDS-PAGE.

• Low protein yield:

  • Challenge: Insufficient recovery of active protein.

  • Solution: Optimize expression conditions by testing lower induction temperatures (16-20°C) and extended expression times (16-24 hours). Consider using specialized E. coli strains designed for membrane protein expression, such as C41(DE3) or C43(DE3).

Implementing these strategies has allowed researchers to achieve preparations with >90% purity and maintained enzymatic activity .

How can researchers troubleshoot low enzyme activity in recombinant UbiA preparations?

When facing low enzymatic activity in recombinant UbiA preparations, a systematic troubleshooting approach is recommended:

• Cofactor requirements verification:

  • Issue: Insufficient Mg²⁺ concentration in reaction buffers.

  • Solution: Titrate Mg²⁺ concentrations (1-20 mM) to determine optimal concentration for your specific preparation, as UbiA requires this divalent cation for optimal activity .

• Substrate quality assessment:

  • Issue: Degraded or impure substrates (4-hydroxybenzoate or prenyl donor).

  • Solution: Verify substrate integrity using analytical methods (HPLC, TLC). Prepare fresh substrate solutions before each assay. Consider testing multiple commercial sources or synthesizing substrates in-house for critical experiments.

• Detergent interference with enzyme function:

  • Issue: Residual detergents from purification inhibiting activity.

  • Solution: Test enzyme function after detergent removal or exchange using detergent-absorbent beads or dialysis. Alternatively, evaluate activity in reconstituted proteoliposomes to provide a more native membrane environment.

• Protein misfolding detection:

  • Issue: Protein appears pure but is incorrectly folded.

  • Solution: Analyze secondary structure using circular dichroism spectroscopy. Compare thermal denaturation profiles of active and inactive preparations. Consider mild denaturation followed by controlled refolding.

• Reductant requirements:

  • Issue: Critical cysteine residues oxidized during purification.

  • Solution: Add reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol) to reaction buffers. Test activity recovery after pre-incubation with reducing agents.

• Enzyme concentration optimization:

  • Issue: Non-linear relationship between enzyme concentration and activity.

  • Solution: Perform activity assays across a wide range of enzyme concentrations to identify optimal working range and potential inhibition at higher concentrations.

• Assay detection sensitivity:

  • Issue: Activity present but below detection threshold.

  • Solution: Implement more sensitive detection methods, such as radiolabeled substrates or coupled enzyme assays that amplify signal output.

This systematic approach has proven effective in recovering activity in apparently inactive UbiA preparations.

What strategies can address expression challenges when working with UbiA from different Burkholderia species?

Expressing UbiA from various Burkholderia species presents unique challenges that can be addressed through these specialized strategies:

• Codon optimization for expression host:

  • Challenge: Burkholderia species often have different codon usage patterns than E. coli.

  • Solution: Perform species-specific codon optimization of the UbiA gene sequence for expression in E. coli. Alternatively, use E. coli strains supplemented with rare tRNAs (e.g., Rosetta strains) to accommodate Burkholderia codon bias.

• Toxicity management:

  • Challenge: Overexpression of membrane proteins like UbiA can be toxic to host cells.

  • Solution: Use tightly controlled inducible expression systems with minimal basal expression. Consider specialized E. coli strains designed for toxic protein expression (C41/C43). Implement a lower-temperature, extended-expression protocol (16-20°C for 16-24 hours).

• Protein solubility enhancement:

  • Challenge: Species-specific variations in UbiA may affect solubility.

  • Solution: Test multiple fusion partners (beyond His-tag), such as MBP, SUMO, or GST, which can enhance solubility. Evaluate the impact of N-terminal versus C-terminal tag placement on expression and function.

• Alternative expression systems:

  • Challenge: E. coli may not provide appropriate folding environment for all Burkholderia UbiA variants.

  • Solution: Consider alternative expression hosts such as Pseudomonas species (more closely related to Burkholderia) or eukaryotic systems like S2 cells for particularly challenging variants.

• Chimeric protein design:

  • Challenge: Some regions of species-specific UbiA may be particularly problematic for expression.

  • Solution: Create chimeric constructs combining successfully expressed regions from one species with problematic regions from another to identify and address specific problematic domains.

• Membrane fraction targeting:

  • Challenge: Improper membrane localization in heterologous hosts.

  • Solution: Include native signal sequences or modulate membrane targeting by adding or removing species-specific signal sequences. Verify membrane localization through fractionation studies.

• Expression vector optimization:

  • Challenge: Standard vectors may not be optimal for all Burkholderia UbiA variants.

  • Solution: Test specialized vectors like pUAST or other expression systems with different promoter strengths and regulatory elements.

These approaches have successfully addressed species-specific expression challenges for various Burkholderia proteins, including UbiA variants from different species within the Burkholderia cepacia complex.

How might UbiA serve as a target for developing novel antimicrobials against Burkholderia infections?

UbiA presents several promising attributes as a potential antimicrobial target against Burkholderia infections:

• Essential metabolic function:

  • UbiA catalyzes a critical step in ubiquinone biosynthesis, which is essential for bacterial respiration and energy production .

  • Disruption of UbiA function could therefore impair bacterial viability or significantly reduce virulence.

• Target validation approach:

  • Generate conditional UbiA mutants in B. vietnamiensis to confirm growth and virulence attenuation.

  • Establish minimum inhibitory UbiA activity reduction required for antimicrobial effect.

  • Determine if UbiA inhibition has synergistic effects with existing antibiotics, particularly aminoglycosides .

• Inhibitor design strategies:

  • Develop high-throughput screening assays for UbiA activity to identify lead compounds.

  • Pursue structure-based drug design targeting:
    a) The active site binding 4-hydroxybenzoate
    b) The prenyl pyrophosphate binding region
    c) Allosteric sites affecting enzyme dynamics
    d) Protein-membrane interaction interfaces

• Selectivity considerations:

  • Compare Burkholderia UbiA with human prenyltransferases (including UbiA prenyltransferase domain-containing 1) .

  • Design inhibitors exploiting structural differences between bacterial and human enzymes.

  • Evaluate inhibitor specificity across multiple bacterial species to determine spectrum of activity.

• Delivery system development:

  • Investigate nanoparticle or liposomal formulations to enhance inhibitor delivery across bacterial membranes.

  • Explore prodrug approaches targeting Burkholderia-specific metabolic pathways for activation.

• Resistance potential assessment:

  • Determine frequency of spontaneous resistance to UbiA inhibitors.

  • Characterize resistance mechanisms through whole-genome sequencing of resistant mutants.

  • Develop inhibitor combinations or dual-targeting approaches to minimize resistance development.

This research direction offers a novel approach to combat Burkholderia infections, particularly relevant for cystic fibrosis patients where B. vietnamiensis can establish chronic infections with developing aminoglycoside resistance .

What are the emerging techniques for investigating structure-function relationships in UbiA proteins?

Recent advances have introduced powerful new methodologies for elucidating UbiA structure-function relationships:

• Cryo-electron microscopy (cryo-EM) applications:

  • High-resolution structural determination of membrane-embedded UbiA without crystallization.

  • Time-resolved cryo-EM to capture conformational changes during catalysis.

  • Single-particle analysis revealing structural heterogeneity relevant to function.

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

  • Mapping protein dynamics and conformational changes during substrate binding.

  • Identifying regions with altered solvent accessibility in different functional states.

  • Comparing dynamics between wild-type and mutant UbiA variants to correlate structural flexibility with function.

• Advanced computational approaches:

  • Molecular dynamics simulations of UbiA in explicit membrane environments.

  • Quantum mechanics/molecular mechanics (QM/MM) calculations for reaction mechanism elucidation.

  • Deep learning-based prediction of structure-function relationships from sequence data.

• Nanobody-based structural biology:

  • Development of conformation-specific nanobodies to stabilize UbiA in defined functional states.

  • Nanobody-assisted crystallization to overcome membrane protein crystallization challenges.

• In-cell structural biology:

  • Site-specific incorporation of unnatural amino acids for in vivo crosslinking studies.

  • Förster resonance energy transfer (FRET) sensors to monitor UbiA conformational changes in living cells.

  • Cellular cryo-electron tomography (cryo-ET) to visualize UbiA in its native membrane context.

• Native mass spectrometry:

  • Analysis of intact UbiA-lipid complexes to identify specific lipid interactions affecting function.

  • Characterization of substrate and cofactor binding under near-native conditions.

• Microfluidics-enabled structural enzymology:

  • Time-resolved small-angle X-ray scattering (TR-SAXS) in microfluidic mixing devices.

  • Rapid-mixing, freeze-quench approaches to capture short-lived catalytic intermediates.

These emerging techniques promise to provide unprecedented insights into the molecular mechanisms of UbiA function, facilitating both fundamental understanding and applied research including inhibitor development.

How can cross-species comparative analysis of UbiA contribute to understanding antibiotic resistance in the Burkholderia cepacia complex?

Cross-species comparative analysis of UbiA represents a powerful approach to understand antibiotic resistance mechanisms in the Burkholderia cepacia complex (BCC):

• Systematic comparative genomics:

  • Compare UbiA sequences across all BCC species, correlating sequence variations with:
    a) Intrinsic aminoglycoside susceptibility patterns (B. vietnamiensis being uniquely susceptible)
    b) Other antibiotic resistance profiles
    c) Clinical vs. environmental source isolates

  • Construct phylogenetic trees of UbiA sequences alongside whole-genome phylogenies to identify convergent evolution patterns.

• Functional comparison methodology:

  • Express and purify UbiA from multiple BCC species under identical conditions.

  • Compare enzymatic parameters (Km, Vmax, substrate specificity) across species.

  • Evaluate membrane integration patterns and lipid interactions of different UbiA proteins.

• Interspecies domain swapping experiments:

  • Generate chimeric UbiA proteins containing domains from different BCC species.

  • Test how these chimeras affect:
    a) Enzymatic activity
    b) Membrane composition
    c) Antibiotic susceptibility profiles, particularly to aminoglycosides

• Cellular impact assessment:

  • Introduce UbiA variants from different species into a common genetic background.

  • Measure changes in:
    a) Antibiotic accumulation (B. vietnamiensis accumulates 5-6× more gentamicin than resistant isolates)
    b) Membrane permeability
    c) Efflux pump activity
    d) Lipopolysaccharide structure, particularly 4-amino-4-deoxy-L-arabinose modifications

• Evolutionary analysis approach:

  • Compare UbiA evolution rates between antibiotic-exposed clinical isolates and environmental isolates.

  • Identify selection pressures acting specifically on UbiA during chronic infection.

  • Correlate evolutionary patterns with development of aminoglycoside resistance in sequential clinical isolates .

• Systems biology integration:

  • Analyze UbiA in the context of species-specific metabolic networks using flux balance analysis.

  • Identify compensatory pathways that differ between BCC species in response to UbiA modulation.

This comparative approach would provide a comprehensive understanding of how UbiA variations contribute to the distinct antibiotic resistance profiles observed across the BCC, potentially revealing new strategies for overcoming resistance in these challenging pathogens.