Recombinant Burkholderia vietnamiensis Lipase chaperone (lifO)

Shipped with Ice Packs
In Stock

Description

Definition and Molecular Role

The Lipase chaperone (lifO) is a foldase required for the post-translational activation of lipases in Burkholderia vietnamiensis. It ensures proper folding of lipases into protease-resistant, catalytically active conformations . Without lifO, lipases misfold into stable but inactive structures, highlighting its role in overcoming energetic barriers during folding .

Key Features:

  • Gene: Encoded by the lifO gene (synonyms: lipB, limA) .

  • Protein: 344 amino acids with a predicted molecular weight of ~38 kDa .

  • Domain: Periplasmic domain (residues 44–353) essential for interaction with lipases .

Mechanism of Action

lifO binds to lipases during late-stage folding, stabilizing their tertiary structure. This interaction is transient but critical for enzymatic activation . Circular dichroism studies confirm that misfolded lipases regain activity only in the presence of lifO .

Production and Purification

Recombinant lifO is typically produced in Escherichia coli via codon-optimized co-expression systems .

Expression Systems

ParameterDetails
HostE. coli BL21(DE3)
VectorpET-based plasmids with His-tags
Yield>85% purity via SDS-PAGE

Biodiesel Production

Co-expression of lifO with lipase (lipA) in E. coli increases enzymatic activity by 3–5×, achieving 90.23% biodiesel yield from rapeseed oil .

ParameterValue
Optimal Temperature50°C
Optimal pH8.0
Methanol ToleranceUp to 30% (v/v)

Biocatalyst Immobilization

Immobilizing lifO-assisted lipases on graphene oxide enhances reusability and activity retention (100% recovery) .

Biochemical Properties

PropertyValue
Specific Activity2080.23 ± 19.18 U/g
ThermostabilityStable at 50°C for 72 hours
Organic Solvent ResistanceRetains >80% activity in 20% methanol

Future Directions

  • Enzyme Engineering: Rational design to improve thermostability and solvent resistance .

  • Large-Scale Fermentation: Optimizing co-expression systems for industrial bioreactors .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will prepare your order according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
lifO; Bcep1808_4393; Lipase chaperone; Lipase activator protein; Lipase foldase; Lipase helper protein; Lipase modulator
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Burkholderia vietnamiensis (strain G4 / LMG 22486) (Burkholderia cepacia (strain R1808))
Target Names
lifO
Target Protein Sequence
MSAQQTRAPLLRRIAPYGAAGLAAIVGVAIWSGTGSQSGADASRTPANAVAADGASAAVR QAALPASAALPAPLVGSSAPRLPLDSGGHLAKVRAVRDFFDYCLTARSELTAAALDALVA REIAAQLDATPAQPEALDVWRRYRAYLDALEKLPDGGAVDKIDPEALQRALDQRASIAHR TLGDWSQPFFGAEQSQQRYDLARLRIVQDRTLTDAQKAERLAALDQQMPADERAARAPAE RQRAALDQIAQLQKSGATPDAVRAQLTQSLGADVAARVVQMQQDDASWQSRYADYAAQRA QIDAAGLSQQDRDAQIAALRQRIFTKPGEAVRAAAFDRSAAGTR
Uniprot No.

Target Background

Function
This protein may be involved in the folding of the extracellular lipase during its passage through the periplasm.
Database Links
Protein Families
Lipase chaperone family
Subcellular Location
Cell inner membrane; Single-pass membrane protein; Periplasmic side.

Q&A

What is Recombinant Burkholderia vietnamiensis Lipase chaperone (lifO)?

Recombinant Burkholderia vietnamiensis Lipase chaperone (lifO) is a molecular chaperone protein originally derived from the bacterium Burkholderia vietnamiensis, now produced through recombinant DNA technology. This protein assists in the proper folding, stability, and activity of lipase enzymes. The recombinant version is typically expressed in heterologous systems to produce purified protein for research applications. Structurally, lifO belongs to the family of lipase-specific foldases that interact with their cognate lipases to ensure proper tertiary structure formation and catalytic functionality. The commercially available recombinant form is typically offered as a partial protein with specific research applications in biochemical and cellular studies .

What are the functional characteristics of lipase chaperones like lifO?

Lipase chaperones such as lifO function as dedicated molecular assistants that facilitate the correct folding of their partner lipases. Unlike general chaperones that assist various proteins, lifO exhibits specificity toward its corresponding lipase. The protein typically contains distinct domains responsible for lipase binding, with specific recognition sites that enable precise protein-protein interactions. These interactions are often characterized by transient binding events that induce conformational changes in the lipase, enabling it to achieve its catalytically active state. Research indicates that in the absence of their specific chaperones, many bacterial lipases remain in inactive conformations, highlighting the essential nature of these chaperone proteins in enzymatic function and regulation.

How does lifO compare structurally to other bacterial lipase chaperones?

The structural organization of lifO shares common features with other bacterial lipase chaperones while maintaining distinct elements specific to Burkholderia species. Typically, these chaperones contain N-terminal domains involved in membrane association and C-terminal regions responsible for lipase recognition. Comparative structural analyses reveal a conserved alpha-helical fold pattern that creates a binding pocket accommodating the lipase partner. Specific amino acid residues within these domains determine chaperone-lipase pairing specificity. The recombinant partial lifO protein maintains critical structural elements necessary for its chaperone function while potentially lacking membrane-association domains that might be present in the native form.

What is the significance of studying lipase chaperones in bacterial systems?

Studying bacterial lipase chaperones like lifO provides valuable insights into protein folding mechanisms, enzyme activation pathways, and bacterial adaptation strategies. These chaperones represent specialized evolutionary solutions to the challenge of producing functional extracellular enzymes. Research in this area contributes to our understanding of how bacteria regulate lipid metabolism, which has implications for biotechnological applications and potential antimicrobial strategies. Additionally, the study of lipase-chaperone interactions serves as a model system for investigating protein-protein interactions and co-evolutionary relationships between functionally linked proteins in bacterial systems.

What are optimal conditions for handling recombinant lifO protein in laboratory settings?

For optimal handling of recombinant Burkholderia vietnamiensis lipase chaperone (lifO), researchers should adhere to specific storage and working conditions. The protein demonstrates highest stability when stored at -80°C for long-term preservation, with aliquoting recommended to avoid repeated freeze-thaw cycles that can compromise function. For working solutions, maintaining the protein in buffers containing 50 mM phosphate, pH 7.0-7.5, with 150 mM NaCl and 10% glycerol helps preserve activity. Research indicates that lifO maintains approximately 85-90% of its activity for up to two weeks when stored at 4°C in appropriate buffer conditions. When designing experiments, it's advisable to include protease inhibitors to prevent degradation, particularly if working with crude extracts or impure preparations .

How can researchers effectively incorporate lifO in ELISA protocols?

When incorporating lifO into ELISA protocols, researchers should consider the following methodological approach:

  • Coating phase: Dilute purified lifO to 1-5 μg/ml in carbonate buffer (pH 9.6) and coat plates overnight at 4°C.

  • Blocking: Use 2-3% BSA in PBS with 0.05% Tween-20 for 1-2 hours at room temperature.

  • Primary antibody incubation: Apply antibodies specific to lifO or its binding partners at optimized dilutions.

  • Detection: Utilize HRP-conjugated secondary antibodies followed by appropriate substrate.

For detecting interactions between lifO and its partner lipase, consider a sandwich ELISA approach where plates are coated with anti-lipase antibodies, then incubated with lipase samples, followed by recombinant lifO and anti-lifO detection antibodies. This approach allows quantification of functional interactions under various experimental conditions. Standard curves should be established using purified recombinant lifO to ensure accurate quantification .

What purification strategies yield highest recovery of active lifO protein?

The purification of recombinant lifO protein typically employs a multi-step approach to ensure high yield and activity. A recommended workflow includes:

Purification StepConditionsExpected RecoveryPurity
Cell lysis50 mM phosphate buffer, pH 7.5 with lysozyme (1 mg/ml) and sonication100% (reference)10-15%
Ammonium sulfate precipitation30-60% saturation75-85%30-40%
Ion exchange chromatographyDEAE or Q-Sepharose, pH gradient 7.0-8.060-70%70-80%
Affinity chromatographyHis-tag or GST-tag based systems50-60%>90%
Size exclusionSuperdex 75/20040-50%>95%

The inclusion of stabilizing agents such as 10% glycerol and 1 mM DTT throughout the purification process significantly enhances protein stability and activity retention. When expressing lifO as a recombinant protein, an inducible expression system with moderate induction (0.1-0.5 mM IPTG) at lower temperatures (16-25°C) often results in higher proportions of soluble, active protein compared to strong induction conditions.

How can researchers design experiments to study lifO-lipase interactions?

To effectively study interactions between lifO and its partner lipase, researchers should consider a multi-faceted experimental approach:

  • In vitro binding assays: Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) provide quantitative measurements of binding kinetics and thermodynamics. Typical experimental parameters include protein concentrations ranging from 10 nM to 1 μM, temperature control at 25°C, and pH maintenance at 7.0-7.5.

  • Functional reconstitution assays: Mix purified lipase with varying concentrations of recombinant lifO (molar ratios from 1:0.5 to 1:5) and measure lipase activity using standardized substrates such as p-nitrophenyl esters. Activity recovery curves typically show sigmoidal response patterns with saturation achieved at specific molar ratios.

  • Structural studies: Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can identify regions of conformational change upon complex formation. For crystallography approaches, co-crystallization typically requires protein concentrations of 5-10 mg/ml in low-ionic-strength buffers.

  • Mutation analysis: Systematic alanine scanning of predicted interface residues can identify critical amino acids involved in the interaction. Comparative binding and activity assays with mutant proteins provide mechanistic insights into the chaperone function.

What applications does lifO have in 3D cell culture research?

Recombinant lifO has emerging applications in 3D cell culture systems, particularly in the following research areas:

  • Extracellular matrix (ECM) modification: lifO can be used to specifically modify lipid components of synthetic ECM materials, potentially enhancing their biocompatibility and cell-instructive properties.

  • Biomaterial functionalization: When immobilized on scaffolding materials, active lipase-lifO complexes can create dynamic surfaces with controlled degradation properties, useful for tissue engineering applications.

  • Lipid metabolism studies: In 3D tumor spheroid models, introducing lifO-lipase systems helps researchers investigate how altered lipid metabolism affects cancer cell behavior in three-dimensional environments.

  • Controlled release systems: lifO-lipase systems incorporated into hydrogels can mediate gradual release of lipophilic compounds through controlled hydrolysis of ester linkages, offering tools for studying drug delivery in tissue-like environments .

What are potential applications of lifO in cell and gene therapy research?

In cell and gene therapy research, recombinant lifO presents several promising applications:

  • Vector modification: lifO-lipase systems can be employed to modify lipid components of viral and non-viral delivery vectors, potentially enhancing transduction efficiency and reducing immunogenicity.

  • Membrane engineering: Controlled modification of cell membranes using lifO-directed lipase activity may improve cell engraftment and survival in therapeutic applications.

  • Metabolic engineering: In CAR-T and other engineered therapeutic cells, expression of lipase with lifO can be used to modulate cellular lipid composition, potentially enhancing function in lipid-rich tumor microenvironments.

  • Bioconjugation strategies: The specific binding properties of lifO can be leveraged to develop novel protein-lipid conjugation methods relevant for therapeutic protein delivery systems .

What common challenges occur when working with recombinant lifO?

Researchers frequently encounter several challenges when working with recombinant Burkholderia vietnamiensis lipase chaperone:

  • Solubility issues: The protein may form inclusion bodies during expression, particularly at high induction levels or elevated temperatures. To address this, consider lysis buffers containing mild detergents (0.1-0.5% Triton X-100) or chaotropic agents (1-2M urea) for initial extraction, followed by step-wise dialysis to remove these additives while maintaining protein solubility.

  • Activity loss during purification: lifO can lose activity during purification procedures, particularly during concentration steps. Incorporating 10% glycerol and 1 mM DTT in buffers, and avoiding excessive concentration (>5 mg/ml) helps preserve functionality.

  • Inconsistent functional assays: When measuring lifO activity through its ability to enhance lipase function, inconsistent results often stem from variable lipase preparations. Standardize lipase sources and establish clear activity baselines before testing lifO effects.

  • Storage instability: Activity loss during storage is common. Implement quality control testing of stored aliquots using functional assays before critical experiments, and consider lyophilization with appropriate cryoprotectants for long-term preservation.

How can researchers distinguish between inactive and active conformations of lifO?

Distinguishing between active and inactive conformations of lifO requires multiple analytical approaches:

MethodParameters MeasuredTypical Indicators of Active Conformation
Circular Dichroism (CD)Secondary structure elementsHigher α-helical content (peaks at 208, 222 nm)
Intrinsic Tryptophan FluorescenceTertiary structureBlue-shifted emission maximum (325-335 nm)
Bis-ANS BindingSurface hydrophobicityLower fluorescence intensity compared to inactive forms
Limited ProteolysisStructural compactnessDistinctive digestion pattern with resistance to certain proteolytic sites
Thermal Shift AssayConformational stabilityHigher melting temperature (Tm)

Additionally, functional assays measuring lipase activation capacity provide the most relevant assessment of lifO activity. Researchers should compare multiple structural parameters alongside functional data to comprehensively characterize the protein's conformational state.

What statistical approaches are appropriate for analyzing lifO-lipase interaction data?

When analyzing interaction data between lifO and its partner lipase, researchers should consider these statistical approaches:

  • For binding kinetics: Non-linear regression analysis using appropriate binding models (one-site, two-site, cooperative) should be applied to SPR or ITC data. The Akaike Information Criterion (AIC) helps select the most appropriate binding model based on the data.

  • For functional activation assays: Dose-response curves should be analyzed using four-parameter logistic regression to determine EC50 values (effective concentration for 50% activation) and Hill coefficients that indicate potential cooperativity.

  • For comparing multiple experimental conditions: ANOVA with appropriate post-hoc tests (Tukey's or Dunnett's) should be used rather than multiple t-tests to minimize type I errors. Effect sizes (Cohen's d or η²) should be reported alongside p-values.

  • For correlation analysis between structural parameters and function: Multiple regression models with stepwise variable selection help identify the most influential structural features affecting chaperone function.

  • For reproducibility assessment: Calculate intra-assay and inter-assay coefficients of variation (CV), with acceptable limits typically below 15% for quantitative measurements.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.