Recombinant Burkholderia vietnamiensis Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag type, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
lspA; Bcep1808_2591; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Burkholderia vietnamiensis (strain G4 / LMG 22486) (Burkholderia cepacia (strain R1808))
Target Names
lspA
Target Protein Sequence
MAKTLSKPASGALAPWLGISLIVILFDQLSKIAILKTFAYGAQHALTSFFNLVLVYNRGA AFGFLSTASGWQRWAFTALGIGATLVICYLLRRHGQQRLFSLSLALILGGALGNVIDRLL YGHVIDFLDFHLGGWHFPAFNLADSAITVGAVLLIYDELRRVRGTR
Uniprot No.

Target Background

Function
This protein is a highly specific catalyst for the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is LspA and what is its function in Burkholderia vietnamiensis?

LspA (Lipoprotein signal peptidase) is an aspartyl protease that functions as a Type II signal peptidase in gram-negative bacteria, including Burkholderia vietnamiensis. This essential enzyme cleaves the transmembrane helix signal peptide of lipoproteins after they have been modified by the addition of a diacylglyceryl moiety . This cleavage is a critical step in the maturation of bacterial lipoproteins, which are important components of the bacterial cell envelope. B. vietnamiensis, classified as genomovar V of the Burkholderia cepacia complex, relies on proper lipoprotein processing for cell envelope integrity and environmental adaptability .

The lipoprotein processing pathway involves sequential actions of prolipoprotein diacylglyceryl transferase (Lgt), which adds the lipid moiety, followed by LspA, which removes the signal peptide. Functional studies of related LspA proteins have shown that this enzymatic activity is essential for bacterial viability and virulence .

How does LspA contribute to bacterial pathogenicity and virulence?

LspA contributes to bacterial pathogenicity through its essential role in processing lipoproteins that mediate various virulence-associated functions. Proper lipoprotein maturation is critical for:

  • Maintaining cellular envelope integrity

  • Facilitating nutrient acquisition systems

  • Enabling adhesion to host tissues

  • Supporting bacterial colonization mechanisms

  • Mediating evasion of host immune responses

Research has demonstrated that LspA is particularly important for pathogenicity in both gram-negative and gram-positive bacteria. In gram-negative organisms like B. vietnamiensis, LspA is essential for viability, while in gram-positive bacteria, it is important for virulence . The B. cepacia complex, which includes B. vietnamiensis, is known to cause opportunistic infections in immunocompromised individuals and cystic fibrosis patients . Proper lipoprotein processing via LspA indirectly supports these bacteria's ability to establish infection and persist in host environments.

Why is Burkholderia vietnamiensis LspA of interest for antibiotic development?

B. vietnamiensis LspA represents an attractive target for antibiotic development for several compelling reasons:

  • Essentiality: LspA is essential for viability in gram-negative bacteria, meaning its inhibition can directly lead to bacterial death .

  • No human homologs: The enzyme has no counterparts in human cells, reducing the potential for off-target effects.

  • Resistance barrier: The active site contains highly conserved residues essential for both enzyme function and inhibitor binding. Research indicates that "resistance mutations arising within the active site to impede antibiotic binding would also likely interfere with the binding and cleavage of substrate... Thus, LspA is a powerful target to combat the development of antibiotic resistance" .

  • Clinical relevance: B. vietnamiensis belongs to the B. cepacia complex, which includes opportunistic pathogens with intrinsic antibiotic resistance that pose significant challenges in healthcare settings .

  • Known inhibition mechanisms: Antibiotics like globomycin have demonstrated inhibition of LspA, providing proof-of-concept for this therapeutic approach .

What are the key structural features of LspA?

LspA possesses several distinct structural features critical to its function as a membrane-embedded signal peptidase:

Structural ElementDescriptionFunctional Significance
Catalytic DyadTwo conserved aspartic acid residuesEssential for proteolytic activity
β-cradleDomain forming part of substrate binding pocketSubstrate recognition and orientation
Periplasmic Helix (PH)Highly conserved flexible helixUndergoes conformational changes during catalytic cycle
Transmembrane SegmentsFour membrane-spanning regionsAnchors protein in bacterial membrane
Active SiteLocated at periplasmic membrane interfaceSite of signal peptide cleavage

Research using molecular dynamics simulations and electron paramagnetic resonance has revealed that LspA exhibits significant conformational flexibility. The enzyme adopts at least three distinct conformational states :

  • Closed state: "The β-cradle and PH are only 6.2 Å apart, completely occluding the charged and polar active site residues"

  • Intermediate state: May represent the substrate-bound or antibiotic-bound conformation

  • Open state: Creates "a trigonal cavity where the lipoprotein, signal peptide, and diacylglyceryl moiety of the lipoprotein substrate are hypothesized to bind"

This conformational plasticity is essential for LspA to accommodate diverse lipoprotein substrates and is a critical consideration for inhibitor design.

How is recombinant B. vietnamiensis LspA typically produced for research?

Production of recombinant B. vietnamiensis LspA involves specialized techniques for membrane protein expression and purification:

  • Gene cloning and vector construction

    • PCR amplification of the lspA gene from B. vietnamiensis genomic DNA

    • Cloning into expression vectors with affinity tags (commonly His6)

    • Verification by sequencing to confirm correct insertion and sequence

  • Expression optimization

    • Selection of appropriate E. coli expression strains (often C41/C43 or BL21 derivatives)

    • Temperature optimization (typically 16-25°C to minimize inclusion body formation)

    • Induction conditions (IPTG concentration, induction time)

    • Membrane protein overexpression can be validated using genetic complementation, as demonstrated with R. typhi LspA which "significantly restores the growth of temperature-sensitive E. coli Y815 at the nonpermissive temperature"

  • Membrane extraction and solubilization

    • Cell lysis by sonication or high-pressure homogenization

    • Membrane fraction isolation by ultracentrifugation

    • Solubilization using mild detergents (e.g., DDM, LMNG)

  • Purification and characterization

    • Affinity chromatography (Ni-NTA for His-tagged proteins)

    • Size exclusion chromatography for final purification

    • Functional validation through enzymatic assays or inhibitor binding studies

    • For structural studies, reconstitution into lipid bilayers or nanodiscs may be necessary

The purified recombinant protein can then be used for biochemical characterization, structural studies, or inhibitor screening assays.

What methods are used to study LspA conformational dynamics?

Understanding LspA conformational dynamics requires a multi-technique approach combining computational and experimental methods:

  • Molecular Dynamics (MD) Simulations

    • Both coarse-grained and atomistic simulations in membrane environments

    • Example methodology: "All simulations were run using GROMACS 2018... The Martini 2.2 force field was used to run an initial 200 ns coarse-grained (CG) MD simulation to permit the assembly and equilibration of a palmitoyloleolylphosphatidylglycerol (POPG) palmitoyloleoylphosphatidylethanolamine (POPE) (1:4 molar ratio) bilayer around LspA"

    • Transition from coarse-grained to atomistic representations using tools like CG2AT

    • Analysis of protein flexibility, especially of the periplasmic helix (PH)

  • Electron Paramagnetic Resonance (EPR) Spectroscopy

    • Site-directed spin labeling (SDSL) of specific residues

    • Continuous wave (CW) EPR to assess local dynamics

    • Double Electron-Electron Resonance (DEER) EPR for distance measurements between labeled sites

    • Critical site selection: "On the β-cradle, a site with reduced backbone dynamics at the end of a β-strand would provide more information about the conformational dynamics between the two domains than a loop site"

  • X-ray Crystallography

    • Structure determination of different functional states

    • Comparison of structures with different bound antibiotics (e.g., globomycin, myxovirescin)

    • Analysis of crystal contacts and potential conformational constraints

  • Hybrid Computational/Experimental Approaches

    • Validation of MD simulations with experimental constraints

    • Direct comparison of simulated and experimental distances: "DEER-PREdict was used to generate I43-A63 distance distributions from the MD trajectories"

    • Modeling of spin labels onto structures from MD trajectories for validation

Each technique provides complementary information about LspA dynamics, with research showing that "the plasticity of antibiotic binding and the conformation states of LspA are identified, providing a better understanding of how therapeutics could inhibit this essential bacterial enzyme. Each approach in isolation has its limitations, and only in combination were we able to visualize and map the conformational dynamics" .

How do molecular dynamics simulations reveal LspA functional mechanisms?

Molecular dynamics (MD) simulations have provided critical insights into LspA functional mechanisms that would be difficult to obtain through experimental approaches alone:

  • Identification of Distinct Conformational States
    MD simulations have revealed at least three functional states of LspA :

    Conformational StateDescriptionFunctional Role
    ClosedPH positioned over active siteProtects polar residues from membrane environment
    IntermediatePartially exposed active siteMay represent inhibitor-bound or transition state
    OpenTrigonal cavity formationRequired for substrate binding and processing
  • Active Site Protection Mechanism
    Simulations revealed that "in the apo state, the dominant conformation is the most closed and occludes the charged active site from the lipid bilayer" . This suggests an evolutionary adaptation to protect the hydrophilic catalytic residues from the hydrophobic membrane environment.

  • Substrate Binding Model
    MD simulations identified the open conformation as "the only structure where lipoprotein substrate could sterically fit in the active site" , providing a structural basis for understanding substrate recognition and processing.

  • Inhibition Mechanisms
    Simulations of LspA bound to antibiotics like globomycin have shown how these molecules stabilize specific conformational states that prevent the enzyme from accessing catalytically productive conformations.

  • Membrane Interactions
    MD simulations in explicit membrane environments reveal how specific lipid-protein interactions influence LspA stability and function within the bacterial membrane.

The methodology typically involves multi-scale approaches, starting with coarse-grained simulations for efficient membrane equilibration, followed by conversion to atomistic resolution for detailed analysis of conformational dynamics and interactions.

What are the challenges in crystallizing LspA in different conformational states?

Obtaining crystal structures of LspA in different functional states presents several significant technical challenges:

  • Membrane Protein Crystallization Difficulties

    • Detergent selection: Finding detergents that maintain protein stability while promoting crystal formation

    • Phase behavior: Navigating complex phase diagrams of protein-detergent-lipid mixtures

    • Crystal packing: Achieving sufficient crystal contacts with limited hydrophilic surface area

  • Conformational Heterogeneity

    • Research indicates that "LspA samples all three of these conformations (closed, intermediate, and open) in all states (apo, globomycin bound, and myxovirescin bound)"

    • This inherent flexibility, while essential for function, hampers crystallization, which typically requires conformational homogeneity

  • Stabilization of Specific States

    • The apo state is particularly challenging to capture due to its dynamic nature

    • While antibiotics can stabilize certain conformations, capturing physiologically relevant states requires careful experimental design

  • Functional Validation

    • Ensuring crystal structures represent functionally relevant conformations rather than crystallization artifacts

    • Complementary techniques like EPR and MD simulations are essential for validation

These challenges explain why "the apo and lipoprotein bound structures of LspA have not been determined and, thus, an understanding of the conformational dynamics associated with substrate binding and signal peptide cleavage is not fully understood" despite their importance for comprehending the enzyme's catalytic cycle.

How does LspA from B. vietnamiensis compare with LspA from other bacterial species?

Comparative analysis of LspA from different bacterial species reveals both conserved features and species-specific adaptations:

Research comparing LspA structures from different species has revealed subtle but important differences: "Structures of LspA from Pseudomonas aeruginosa (LspPae) and Staphylococcus aureus (LspMrs) were determined with the antibiotic globomycin bound, and LspMrs was also captured with the antibiotic myxovirescin bound" . These structures show variations in:

  • The conformation of the periplasmic helix (PH)

  • Modes of antibiotic binding

  • Surface features that may influence membrane interactions

As a member of the B. cepacia complex, B. vietnamiensis LspA likely possesses adaptations related to this organism's environmental versatility and pathogenic potential . These species-specific features may be leveraged for the development of targeted inhibitors with reduced broad-spectrum activity.

What experimental approaches are most effective for studying LspA inhibitors?

Several complementary experimental approaches have proven valuable for studying LspA inhibitors:

  • Enzymatic Assays

    • Fluorogenic peptide substrate cleavage assays

    • FRET-based lipoprotein processing assays

    • Quantitative measurement of inhibition constants (IC50/Ki)

  • Bacterial Growth Inhibition

    • Minimum inhibitory concentration (MIC) determination

    • Time-kill kinetics in B. vietnamiensis cultures

    • Genetic complementation assays using temperature-sensitive E. coli strains, similar to those used with R. typhi LspA which "significantly restores the growth of temperature-sensitive E. coli Y815 at the nonpermissive temperature"

  • Resistance Profiling

    • Globomycin resistance assays: "Overexpression of R. typhi lspA in Escherichia coli confers increased globomycin resistance"

    • Selection and characterization of resistant mutants

    • Cross-resistance analysis between different inhibitor classes

  • Structural Studies

    • X-ray crystallography of LspA-inhibitor complexes

    • HDX-MS to identify inhibitor binding sites and conformational effects

    • Cryo-EM of larger complexes with inhibitors

  • Binding Kinetics

    • Surface plasmon resonance (SPR) for on/off rate determination

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Microscale thermophoresis (MST) for binding affinity measurements

  • Computational Methods

    • Molecular docking for virtual screening

    • MD simulations of LspA-inhibitor complexes to assess "how the antibiotic stabilizes specific conformational states that prevent substrate binding and processing"

    • Free energy calculations for binding affinity estimation

A comprehensive inhibitor characterization approach combines these methods to develop a complete profile of inhibitory mechanisms, specificity, and resistance potential.

How can site-directed mutagenesis be used to investigate LspA active site?

Site-directed mutagenesis provides powerful insights into LspA structure-function relationships through systematic modification of key residues:

  • Catalytic Mechanism Dissection

    • Mutation of catalytic aspartate residues to asparagine to confirm their essential role

    • Mutation of non-catalytic active site residues to assess contribution to substrate positioning

    • Charge-reversal mutations to probe electrostatic interactions

  • Substrate Binding Determinants

    • Alanine scanning of the "14 additional highly conserved residues that surround the active site"

    • Conservative substitutions to maintain structure while altering specific interactions

    • Creation of chimeric enzymes combining regions from different bacterial species

  • Conformational Dynamics Modification

    • Introduction of proline residues to restrict flexibility of the periplasmic helix

    • Disulfide engineering to lock specific conformational states

    • Glycine substitutions to increase local flexibility

  • Inhibitor Resistance Mechanisms

    • Generation of mutations that confer resistance to LspA inhibitors

    • Testing the hypothesis that "resistance mutations arising within the active site to impede antibiotic binding would also likely interfere with the binding and cleavage of substrate"

  • Membrane Interaction Studies

    • Mutation of residues at the membrane-water interface

    • Alteration of hydrophobic residues in transmembrane segments

  • EPR Experiments

    • Strategic introduction of cysteine residues for spin labeling

    • Careful selection of labeling sites as demonstrated in research where "residues I43, F47, and W130 were candidates for labeling of the β-cradle"

The impact of mutations is typically assessed through a combination of:

  • Enzymatic activity assays

  • Bacterial complementation studies

  • Structural analyses (EPR, crystallography)

  • Computational methods (MD simulations)

This multi-faceted approach provides comprehensive insights into the structural basis of LspA function.

What are the latest findings on LspA's role in bacterial membrane biogenesis?

Recent research has expanded our understanding of LspA's role beyond simple lipoprotein processing to reveal its integral function in coordinated membrane biogenesis:

  • Coordinated Expression with Other Processing Enzymes
    Research in Rickettsia has shown that "The transcription of lspA, lgt (encoding prolipoprotein transferase), and lepB (encoding type I signal peptidase)... reveals a differential expression pattern during various stages of rickettsial intracellular growth" . This suggests sophisticated regulatory mechanisms that likely extend to B. vietnamiensis as well.

  • Critical Role in Infection Competence
    Studies have found that "The higher transcriptional level of all three genes at the preinfection time point indicates that only live and metabolically active rickettsiae are capable of infection and inducing host cell phagocytosis" , highlighting LspA's importance in bacterial-host interactions.

  • Balanced Protein Secretion Pathways
    Research indicates that "lepB, which is involved in nonlipoprotein secretion, shows a higher level of expression, suggesting that LepB is the major signal peptidase for protein secretion and supporting our in silico prediction that out of 89 secretory proteins, only 14 are lipoproteins" . This demonstrates that LspA processes a selective subset of secretory proteins.

  • Conformational Protection Mechanism
    Structural and dynamic studies reveal an elegant evolutionary adaptation where "in the apo state, the dominant conformation is the most closed and occludes the charged active site from the lipid bilayer" , protecting the catalytic machinery from the hydrophobic membrane environment.

  • Lipid-Protein Interactions
    Research suggests specific interactions between LspA and membrane lipids, as evidenced by the careful composition of lipid bilayers in MD simulations (POPG:POPE at 1:4 molar ratio) designed to mimic physiologically relevant conditions.

These findings collectively position LspA as an integral component of a sophisticated membrane biogenesis network rather than simply an isolated processing enzyme, with important implications for understanding both normal bacterial physiology and designing intervention strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.