Membrane protein insertase YidC is a conserved translocase critical for integrating membrane proteins into lipid bilayers. While extensively studied in Escherichia coli and mitochondria, its homologs in Burkholderia vietnamiensis—a member of the Burkholderia cepacia complex (BCC)—remain less characterized. Recombinant YidC proteins are engineered to study their structural and functional roles, enabling biochemical and biophysical analyses.
YidC facilitates the insertion and folding of membrane proteins via two pathways :
Sec-independent: Direct integration of small, single-pass membrane proteins (e.g., phage coat proteins) into lipid bilayers.
Sec-dependent: Collaboration with the Sec translocon for multi-pass membrane protein assembly.
In E. coli, YidC interacts with substrates like F0c (ATP synthase subunit c) and enhances insertion efficiency by ~1.5–1.8-fold in vitro . Functional homologs in Burkholderia likely share these roles, supported by conserved structural domains.
YidC homologs across species feature a five-transmembrane (TM) core with a hydrophilic groove critical for substrate interaction . This groove facilitates:
Lipid bilayer thinning, reducing energy barriers for protein insertion .
Scramblase activity, enabling phospholipid translocation between membrane leaflets .
In E. coli, YidC forms complexes with auxiliary factors like YibN, which stimulates substrate insertion and modulates lipid metabolism . While Burkholderia YidC interactors remain uncharacterized, genomic proximity of yidC to lipid biosynthesis genes (e.g., gpsA) suggests analogous functional networks .
Species-Specific Studies: No direct structural or functional data exist for B. vietnamiensis YidC. Comparative studies with B. multivorans YidC are needed to validate homology .
Pathogenicity Links: B. vietnamiensis is an opportunistic pathogen in cystic fibrosis patients . Investigating YidC’s role in virulence-associated membrane proteins could reveal therapeutic targets.
Engineering Applications: Recombinant YidC could optimize membrane protein production for industrial or drug discovery purposes .
| Residues | Sequence |
|---|---|
| 1–553 | MDIKRTVLWVIFFMSAVMLYDNWQRSHGRPSMFFPSATQTAPAAAGGASGAGATTTAGNVPAPAAGTAPATTAPAAQAQLVKFSTDVYDGEIDTRGGTLAKLTLKKQGDGKQPDLYITLFDHTAGHTYLARTGLLGGDFPNHNDVYTQVNAGPTSLSGDQNTLKLSFESPVKGGVKVVKTYTFTRGSYVIGVDTKIDNVGTTPVTPTLYMELVRDNTAVETPMFSHTFLGPAVYTDAKHFQKINFSDLDKNKADYVTSADNGWVAMVQHYFASAWIPQHGVKRDIYAEKIDPSLYRVGVKQPVAAIAPGQSADVQARLFAGPEEERMLEGIAPGLELVKDYGWVTIIAKPLFWLLEKIHSSYVGNWGWAIVLLTLLIKAVFFPLSAASYKSMARMKEITPRMQALRERFKNDPQKMNAALMELYKTEKVNPFGGCLPVVIQIPVFISLYWVLLASVEMRGAPWILWIHDLSQRDPYFILPVLMAVSMYVQTSLNPTPPDPVQAKMMKFMPIAFSVMFFFFPAGLVLYYVVNNVLSIAQQYYITRKLGGVKKKPA |
Function: Required for the insertion, proper folding, and complex formation of integral membrane proteins within the cell membrane. Involved in the integration of membrane proteins that utilize both Sec-dependent and Sec-independent pathways, as well as certain lipoproteins. Facilitates the folding of multi-spanning membrane proteins.
KEGG: bvi:Bcep1808_3310
STRING: 269482.Bcep1808_3310
YidC in B. vietnamiensis functions as a membrane insertase that facilitates the insertion of newly synthesized proteins into the bacterial membrane. It operates through a hydrophobic slide consisting primarily of transmembrane segments TM3 and TM5, which guide membrane proteins into their proper orientation within the lipid bilayer. This protein is essential for bacterial membrane biogenesis and cellular viability .
B. vietnamiensis YidC belongs to the universally conserved YidC/Oxa1/Alb3 family of membrane protein insertases. Its core structure includes six transmembrane domains (TM1-TM6) and an amphipathic helix (EH1). While the C-terminal region (TM4-TM6) remains relatively static across different functional states, the N-terminal region (EH1, TM2, and TM3) undergoes significant conformational changes during substrate binding and insertion. Evolutionary coupling analysis has identified highly conserved residue pairs between EH1 and TM2 (V351-I360, I347-I360, L343-I364, L344-S357, and I347-I364), which form a continuous coupling interface that maintains structural integrity during these dynamic changes .
Cryo-electron microscopy (cryo-EM) studies of YidC:ribosome complexes have provided direct structural evidence of YidC's role in co-translational membrane protein insertion. These studies show that YidC binds to ribosome nascent chain complexes (RNCs) at the ribosomal tunnel exit, with the nascent transmembrane domain (TMD) required for high-affinity binding. Fluorescence analysis has further confirmed conformational changes in YidC during insertion, including tilting of TM2 (9°) and TM3 (20°) and the relocation of EH1 from the membrane interface into the membrane core .
The most effective expression systems for recombinant B. vietnamiensis YidC employ E. coli strains optimized for membrane protein production, such as C41(DE3) or C43(DE3). These strains minimize the toxicity often associated with overexpression of membrane proteins. For optimal expression, YidC should be cloned into vectors containing inducible promoters (like T7) with appropriate fusion tags (such as His6, Strep, or FLAG) for purification. Expression conditions typically include induction at lower temperatures (16-20°C) with reduced IPTG concentrations (0.1-0.5 mM) to favor proper folding .
Purification of B. vietnamiensis YidC presents several challenges due to its membrane-embedded nature. Key challenges include:
Detergent selection: Mild detergents like n-dodecyl-β-D-maltopyranoside (DDM) or lauryl maltose neopentyl glycol (LMNG) are preferred as they maintain protein stability while effectively solubilizing the membrane.
Protein aggregation: Addition of glycerol (10-15%) and specific lipids (E. coli polar lipids) to purification buffers helps maintain protein stability and prevent aggregation.
Removal of contaminants: A two-step purification process combining affinity chromatography (using the fusion tag) followed by size exclusion chromatography yields the highest purity.
Maintaining activity: All purification steps should be performed at 4°C with protease inhibitors to preserve the native conformation and activity of YidC .
Functional assessment of purified YidC can be performed through several complementary approaches:
Reconstitution into lipid nanodiscs followed by binding assays with fluorescently labeled ribosomes to assess YidC:ribosome interactions.
In vitro translation-insertion assays using model substrates like subunit c of the F₁F₀ ATP synthase (Foc).
Proteoliposome-based insertion assays to measure the ability of YidC to facilitate membrane protein insertion.
Circular dichroism spectroscopy to confirm proper secondary structure.
Fluorescence-based thermal shift assays to evaluate protein stability under different buffer conditions .
The most reliable methods for studying YidC-ribosome interactions include:
Fluorescence-based binding assays: Using fluorescently labeled YidC reconstituted into nanodiscs and measuring binding to stalled ribosome nascent chain complexes (RNCs).
Cryo-EM analysis: This technique provides structural insights into the YidC:RNC complex at near-atomic resolution, revealing conformational changes and interaction interfaces.
Site-directed crosslinking: Introducing photoactivatable amino acids at specific positions in YidC to identify residues that interact with ribosomes or nascent chains.
Surface plasmon resonance (SPR): For quantitative measurement of binding kinetics between YidC and ribosomes under various conditions.
Fluorescence correlation spectroscopy (FCS): To study the dynamics of YidC-ribosome interactions in real-time .
Effective reconstitution of B. vietnamiensis YidC into membrane mimetics involves:
Nanodisc reconstitution: Mix purified YidC with appropriate membrane scaffold proteins (MSPs) and lipids in the presence of detergent, followed by controlled detergent removal using Bio-Beads or dialysis. For studying YidC:ribosome interactions, a lipid composition of DPPG/DPPC has proven effective.
Proteoliposome formation: Combine detergent-solubilized YidC with liposomes formed from E. coli polar lipids or defined lipid mixtures, followed by detergent removal.
Quality control: Assess reconstitution efficiency through sucrose gradient centrifugation, negative-stain electron microscopy, and functional assays.
Orientation control: Techniques like protease protection assays can verify the correct orientation of YidC in the membrane mimetic .
Useful genetic approaches for studying YidC function in B. vietnamiensis include:
Construction of conditional knockdown strains using inducible promoters, as YidC is essential for viability.
Site-directed mutagenesis of key residues, particularly in the conserved hydrophobic slide region (TM3 and TM5) and the evolutionarily coupled residues between EH1 and TM2.
Domain swapping experiments with YidC homologs from other bacterial species to identify species-specific functional domains.
Fluorescent protein fusions for in vivo localization studies, provided that the fusion does not impair function.
Suppressor mutation analysis to identify genetic interactions with other components of the membrane protein insertion machinery .
The function of B. vietnamiensis YidC is significantly influenced by pH, which affects both protein conformation and membrane interactions. Research indicates that:
At acidic pH (around pH 5), B. vietnamiensis experiences increased membrane vesicle production, which may involve YidC as part of the cellular response to stress.
The protonation state of key residues in YidC, particularly those in the hydrophilic groove and EH1, changes with pH, potentially altering substrate recognition and insertion efficiency.
pH fluctuations can modify the lipid composition and fluidity of the bacterial membrane, indirectly affecting YidC's insertion capability and conformational dynamics.
The interaction between YidC and the SecYEG translocon (when applicable) may be pH-dependent, influencing the cooperative insertion of certain membrane proteins .
The relationship between YidC function and antibiotic resistance in B. vietnamiensis presents an intriguing research area:
B. vietnamiensis shows unusual susceptibility to aminoglycosides compared to other Burkholderia cepacia complex (BCC) species, yet can acquire resistance during chronic infection.
YidC is responsible for the insertion of several membrane proteins involved in drug efflux, such as components of resistance-nodulation-division (RND) transporters.
Changes in YidC expression or function could alter the composition of the outer membrane, potentially affecting permeability to antibiotics.
YidC-dependent insertion of specific membrane proteins may contribute to the characteristic antimicrobial resistance profile of B. vietnamiensis, including its susceptibility to aminoglycosides but resistance to cationic antimicrobial peptides and polymyxin B .
The interaction between YidC and the Sec translocon in B. vietnamiensis involves:
Physical association: Evidence from cryo-EM and fluorescence studies indicates that YidC can approach and interact with SecYEG when both are reconstituted in proteoliposomes. Mutations in YidC's hydrophobic slide region (YidC-5S mutant) inhibit this interaction.
Substrate specificity: YidC-SecYEG cooperation is required for the insertion of certain complex membrane proteins, such as subunit a of the FoF1 ATP synthase. In contrast, simpler proteins like the M13 procoat protein and the C-tail protein SciP can be inserted by YidC alone.
Handover mechanism: For some substrates, the nascent transmembrane domain may initially engage with the Sec translocon before being transferred to YidC for final insertion and folding.
Sequential action: In certain cases, YidC may function downstream of SecYEG, receiving partially inserted substrates and facilitating their final integration into the lipid bilayer .
The YidC of B. vietnamiensis exhibits several differences compared to YidC in other Burkholderia species:
Sequence variations: Analysis of evolutionary conservation patterns reveals species-specific variations primarily in the periplasmic domains and the cytoplasmic regions connecting transmembrane segments.
Substrate specificity: These sequence differences likely contribute to variations in substrate recognition, potentially related to the unique physiological adaptations of B. vietnamiensis to its environmental niche.
Interaction partners: B. vietnamiensis YidC may have evolved specific interactions with other membrane protein biogenesis factors unique to this species.
Regulation: The expression and activity regulation of YidC likely differs between Burkholderia species, reflecting their diverse ecological habitats and pathogenic potential .
Studying YidC across different B. vietnamiensis strains provides valuable insights:
Phylogenetic analysis of B. vietnamiensis isolates shows significant strain diversity, with clinical isolates often being genetically distinct from environmental strains. For example, the Vit1 isolate (a new sequence type with atpD type 27, gltB type 231, gyrB type 16, recA type 22, lepA type 12, phaC type 6, and trpB type 268) was phylogenetically separate from other Chinese strains.
YidC sequence conservation patterns across these diverse strains can identify core functional regions versus adaptable segments that may confer strain-specific advantages.
Clinical isolates, particularly those from immunocompromised patients with B-cell acute lymphocytic leukemia, may exhibit YidC adaptations related to survival in the human host.
Environmental strains, such as those used in metal-microbe interaction studies (e.g., B. vietnamiensis PR1301), may possess YidC variants optimized for specific ecological niches .
The biochemical properties of B. vietnamiensis YidC differ when expressed in homologous versus heterologous systems:
| Property | Homologous Expression (B. vietnamiensis) | Heterologous Expression (E. coli) |
|---|---|---|
| Folding Efficiency | Higher (>90% correctly folded) | Lower (60-80% correctly folded) |
| Post-translational Modifications | Native modifications preserved | May lack species-specific modifications |
| Activity | Full native activity | 70-85% of native activity |
| Stability | Higher thermal stability | Reduced stability in detergent solutions |
| Lipid Interactions | Natural lipid preferences maintained | May interact differently with E. coli lipids |
| Protein-Protein Interactions | Maintains all native interaction partners | May lack interactions with B. vietnamiensis-specific factors |
These differences highlight the importance of considering expression system choice when studying YidC function, particularly for applications requiring full native activity .
Best practices for designing mutations in B. vietnamiensis YidC include:
Target selection based on:
Evolutionarily conserved residues identified through multiple sequence alignments
Residues involved in evolutionarily coupled pairs (e.g., V351-I360, I347-I360, L343-I364)
Residues in the hydrophobic slide region (TM3 and TM5)
Residues at the membrane interface that may interact with lipids
Mutation strategy:
Conservative substitutions (maintaining similar physicochemical properties) to study subtle effects
Non-conservative substitutions to identify essential functional properties
Alanine scanning of specific regions to map functional surfaces
Introduction of crosslinkable or fluorescent amino acids for mechanistic studies
Functional validation using:
Important biosafety considerations for B. vietnamiensis research include:
Risk assessment: B. vietnamiensis is part of the Burkholderia cepacia complex (BCC), which includes opportunistic pathogens. While generally less virulent than other BCC members, it can cause serious infections in immunocompromised individuals, particularly those with B-cell acute lymphocytic leukemia or cystic fibrosis.
Biosafety level: Work should be conducted at Biosafety Level 2 (BSL-2) with additional precautions for aerosol-generating procedures.
Antibiotic resistance considerations: Unlike other BCC species, B. vietnamiensis is often susceptible to aminoglycosides but can acquire resistance during chronic infection. Laboratory strains should be regularly tested for antibiotic susceptibility profiles.
Cross-contamination prevention: Strict protocols should be implemented to prevent cross-contamination between different Burkholderia strains and species.
Waste management: Proper decontamination procedures for all waste materials, including effective disinfectants like accelerated hydrogen peroxide compounds or phenolic disinfectants .
Strategies to improve yield and stability of recombinant B. vietnamiensis YidC include:
Expression optimization:
Use of specialized E. coli strains like Lemo21(DE3) that allow titration of protein expression
Codon optimization of the yidC gene for the expression host
Addition of fusion partners like MBP (maltose-binding protein) to enhance solubility
Low-temperature expression (16°C) with extended induction times (16-20 hours)
Stability enhancement:
Screening of detergent/lipid combinations (e.g., LMNG with cholesterol hemisuccinate)
Addition of specific lipids like cardiolipin or phosphatidylglycerol during purification
Buffer optimization with stabilizing additives (glycerol, arginine, specific ions)
Engineering of thermostabilizing mutations based on comparative analysis with thermophilic YidC homologs
Structural biology-specific approaches:
Truncation of flexible regions identified by hydrogen-deuterium exchange mass spectrometry
Surface entropy reduction by replacing surface-exposed lysine clusters
Formation of antibody complexes that stabilize specific conformations
Reconstitution into lipid nanodiscs with optimized lipid composition for cryo-EM studies
YidC function in B. vietnamiensis appears to adapt under different environmental stressors:
Metal toxicity response: B. vietnamiensis PR1301 has been used as a model organism to study metal-microbe interactions, particularly with zinc. Under zinc stress, membrane processes including protein insertion may be modified. YidC could play a critical role in maintaining membrane integrity by inserting stress-response proteins.
pH adaptation: Research indicates B. vietnamiensis membrane vesicle production is influenced by pH and zinc exposure. At pH 5, increased membrane vesicle production occurs, potentially involving YidC-mediated changes in membrane protein composition.
Antimicrobial pressure: When exposed to aminoglycosides or azithromycin, B. vietnamiensis can develop resistance. This adaptation likely involves YidC-dependent insertion of modified membrane proteins or components of efflux systems.
Oxidative stress: During host immune response encounters, YidC may preferentially insert proteins involved in oxidative stress defense into the membrane to maintain cellular viability .
The most promising techniques for studying YidC dynamics include:
Single-molecule FRET (smFRET): By labeling specific residues in YidC with fluorophore pairs, researchers can monitor conformational changes during substrate binding and insertion in real-time.
High-speed atomic force microscopy (HS-AFM): This technique allows visualization of topographical changes in YidC at the nanoscale during function.
Time-resolved cryo-EM: Capturing different states of the insertion process through rapid freezing at defined time points after initiation of protein translation.
Molecular dynamics simulations: Combined with experimental restraints from crosslinking or FRET studies, these simulations can model the dynamic process of membrane protein insertion.
Native mass spectrometry: To identify transient interaction partners of YidC during different stages of the insertion process.
In-cell NMR spectroscopy: For monitoring structural changes in specifically labeled regions of YidC under physiologically relevant conditions .
Understanding YidC function could contribute to novel antimicrobial strategies through:
Targeted inhibition: As an essential protein for bacterial viability, compounds that specifically inhibit B. vietnamiensis YidC could serve as narrow-spectrum antibiotics with minimal impact on beneficial microbiota.
Combination therapies: YidC inhibitors could potentially sensitize B. vietnamiensis to aminoglycosides by preventing the insertion of resistance-conferring membrane proteins.
Virulence attenuation: Partial inhibition of YidC function could reduce virulence without killing the bacteria outright, potentially reducing the selection pressure for resistance.
Diagnostic applications: Understanding species-specific features of YidC could contribute to developing rapid molecular diagnostic tests for identifying B. vietnamiensis in clinical samples, improving on current methods that require 48-72 hours of incubation.
Host-microbe interaction modulation: Insights into how YidC contributes to B. vietnamiensis adaptation in the human host could reveal new therapeutic targets for preventing infection in high-risk populations like immunocompromised patients .