Recombinant Burkholderia vietnamiensis Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction to Membrane Protein Insertase YidC in Burkholderia vietnamiensis

Membrane protein insertase YidC is a conserved translocase critical for integrating membrane proteins into lipid bilayers. While extensively studied in Escherichia coli and mitochondria, its homologs in Burkholderia vietnamiensis—a member of the Burkholderia cepacia complex (BCC)—remain less characterized. Recombinant YidC proteins are engineered to study their structural and functional roles, enabling biochemical and biophysical analyses.

Functional Role of YidC in Membrane Protein Biogenesis

YidC facilitates the insertion and folding of membrane proteins via two pathways :

  1. Sec-independent: Direct integration of small, single-pass membrane proteins (e.g., phage coat proteins) into lipid bilayers.

  2. Sec-dependent: Collaboration with the Sec translocon for multi-pass membrane protein assembly.

In E. coli, YidC interacts with substrates like F0c (ATP synthase subunit c) and enhances insertion efficiency by ~1.5–1.8-fold in vitro . Functional homologs in Burkholderia likely share these roles, supported by conserved structural domains.

4.1. Conserved Architecture

YidC homologs across species feature a five-transmembrane (TM) core with a hydrophilic groove critical for substrate interaction . This groove facilitates:

  • Lipid bilayer thinning, reducing energy barriers for protein insertion .

  • Scramblase activity, enabling phospholipid translocation between membrane leaflets .

4.2. Interaction Partners

In E. coli, YidC forms complexes with auxiliary factors like YibN, which stimulates substrate insertion and modulates lipid metabolism . While Burkholderia YidC interactors remain uncharacterized, genomic proximity of yidC to lipid biosynthesis genes (e.g., gpsA) suggests analogous functional networks .

Research Gaps and Future Directions

  1. Species-Specific Studies: No direct structural or functional data exist for B. vietnamiensis YidC. Comparative studies with B. multivorans YidC are needed to validate homology .

  2. Pathogenicity Links: B. vietnamiensis is an opportunistic pathogen in cystic fibrosis patients . Investigating YidC’s role in virulence-associated membrane proteins could reveal therapeutic targets.

  3. Engineering Applications: Recombinant YidC could optimize membrane protein production for industrial or drug discovery purposes .

6.1. Amino Acid Sequence of Burkholderia multivorans YidC

ResiduesSequence
1–553MDIKRTVLWVIFFMSAVMLYDNWQRSHGRPSMFFPSATQTAPAAAGGASGAGATTTAGNVPAPAAGTAPATTAPAAQAQLVKFSTDVYDGEIDTRGGTLAKLTLKKQGDGKQPDLYITLFDHTAGHTYLARTGLLGGDFPNHNDVYTQVNAGPTSLSGDQNTLKLSFESPVKGGVKVVKTYTFTRGSYVIGVDTKIDNVGTTPVTPTLYMELVRDNTAVETPMFSHTFLGPAVYTDAKHFQKINFSDLDKNKADYVTSADNGWVAMVQHYFASAWIPQHGVKRDIYAEKIDPSLYRVGVKQPVAAIAPGQSADVQARLFAGPEEERMLEGIAPGLELVKDYGWVTIIAKPLFWLLEKIHSSYVGNWGWAIVLLTLLIKAVFFPLSAASYKSMARMKEITPRMQALRERFKNDPQKMNAALMELYKTEKVNPFGGCLPVVIQIPVFISLYWVLLASVEMRGAPWILWIHDLSQRDPYFILPVLMAVSMYVQTSLNPTPPDPVQAKMMKFMPIAFSVMFFFFPAGLVLYYVVNNVLSIAQQYYITRKLGGVKKKPA

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. To specify a tag type, please inform us, and we will prioritize its development.
Synonyms
yidC; Bcep1808_3310; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-554
Protein Length
full length protein
Species
Burkholderia vietnamiensis (strain G4 / LMG 22486) (Burkholderia cepacia (strain R1808))
Target Names
yidC
Target Protein Sequence
MDIKRTVLWVIFFMSAVMLYDNWQRDHGRPSMFFPSATQTAPAAASGASGTGATTTAGEA PAAAAAGAAPATTAPAAQAQLVKFSTDVYDGEIDTRGGTLAKLTLKKQGDGKQPDLYITL FDHTAGHTYLARTGLLGGDFPNHNDVYTQLNPGATSLTGDQNTLKLSFESPVKGGVKVVK TYTFTRGSYVIGVDTKIDNVGTAPVTPTVYMELVRDNTAVETPMFSHTFLGPAVYTDAKH FQKINFSDLDKNKADYVNSADNGWVAMVQHYFASAWIPQQGVKRDIYAEKIDPSLYRVGV KQPVAAIAPGQSADVQARLFAGPEEERMLEGIAPGLELVKDYGWVTIIAKPLFWLLEKIH GVVGNWGWAIVLLTILIKAVFFPLSAASYKSMARMKEITPRMQALRERFKSDPQKMNAAL MELYKTEKVNPFGGCLPVVIQIPVFISLYWVLLASVEMRGAPWILWIHDLSQRDPFFILP VLMAVSMYVQTSLNPTPPDPVQAKMMKFMPIAFSVMFFFFPAGLVLYYVVNNVLSIAQQY YITRKLGGVKKKPA
Uniprot No.

Target Background

Function

Function: Required for the insertion, proper folding, and complex formation of integral membrane proteins within the cell membrane. Involved in the integration of membrane proteins that utilize both Sec-dependent and Sec-independent pathways, as well as certain lipoproteins. Facilitates the folding of multi-spanning membrane proteins.

Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of YidC in Burkholderia vietnamiensis?

YidC in B. vietnamiensis functions as a membrane insertase that facilitates the insertion of newly synthesized proteins into the bacterial membrane. It operates through a hydrophobic slide consisting primarily of transmembrane segments TM3 and TM5, which guide membrane proteins into their proper orientation within the lipid bilayer. This protein is essential for bacterial membrane biogenesis and cellular viability .

How does the structure of B. vietnamiensis YidC compare to other bacterial homologs?

B. vietnamiensis YidC belongs to the universally conserved YidC/Oxa1/Alb3 family of membrane protein insertases. Its core structure includes six transmembrane domains (TM1-TM6) and an amphipathic helix (EH1). While the C-terminal region (TM4-TM6) remains relatively static across different functional states, the N-terminal region (EH1, TM2, and TM3) undergoes significant conformational changes during substrate binding and insertion. Evolutionary coupling analysis has identified highly conserved residue pairs between EH1 and TM2 (V351-I360, I347-I360, L343-I364, L344-S357, and I347-I364), which form a continuous coupling interface that maintains structural integrity during these dynamic changes .

What experimental evidence supports YidC's role in membrane protein insertion in B. vietnamiensis?

Cryo-electron microscopy (cryo-EM) studies of YidC:ribosome complexes have provided direct structural evidence of YidC's role in co-translational membrane protein insertion. These studies show that YidC binds to ribosome nascent chain complexes (RNCs) at the ribosomal tunnel exit, with the nascent transmembrane domain (TMD) required for high-affinity binding. Fluorescence analysis has further confirmed conformational changes in YidC during insertion, including tilting of TM2 (9°) and TM3 (20°) and the relocation of EH1 from the membrane interface into the membrane core .

What expression systems are most effective for producing recombinant B. vietnamiensis YidC?

The most effective expression systems for recombinant B. vietnamiensis YidC employ E. coli strains optimized for membrane protein production, such as C41(DE3) or C43(DE3). These strains minimize the toxicity often associated with overexpression of membrane proteins. For optimal expression, YidC should be cloned into vectors containing inducible promoters (like T7) with appropriate fusion tags (such as His6, Strep, or FLAG) for purification. Expression conditions typically include induction at lower temperatures (16-20°C) with reduced IPTG concentrations (0.1-0.5 mM) to favor proper folding .

What purification challenges are specific to B. vietnamiensis YidC, and how can they be addressed?

Purification of B. vietnamiensis YidC presents several challenges due to its membrane-embedded nature. Key challenges include:

  • Detergent selection: Mild detergents like n-dodecyl-β-D-maltopyranoside (DDM) or lauryl maltose neopentyl glycol (LMNG) are preferred as they maintain protein stability while effectively solubilizing the membrane.

  • Protein aggregation: Addition of glycerol (10-15%) and specific lipids (E. coli polar lipids) to purification buffers helps maintain protein stability and prevent aggregation.

  • Removal of contaminants: A two-step purification process combining affinity chromatography (using the fusion tag) followed by size exclusion chromatography yields the highest purity.

  • Maintaining activity: All purification steps should be performed at 4°C with protease inhibitors to preserve the native conformation and activity of YidC .

How can researchers assess the functional integrity of purified recombinant YidC?

Functional assessment of purified YidC can be performed through several complementary approaches:

  • Reconstitution into lipid nanodiscs followed by binding assays with fluorescently labeled ribosomes to assess YidC:ribosome interactions.

  • In vitro translation-insertion assays using model substrates like subunit c of the F₁F₀ ATP synthase (Foc).

  • Proteoliposome-based insertion assays to measure the ability of YidC to facilitate membrane protein insertion.

  • Circular dichroism spectroscopy to confirm proper secondary structure.

  • Fluorescence-based thermal shift assays to evaluate protein stability under different buffer conditions .

What are the most reliable methods for studying YidC-ribosome interactions?

The most reliable methods for studying YidC-ribosome interactions include:

  • Fluorescence-based binding assays: Using fluorescently labeled YidC reconstituted into nanodiscs and measuring binding to stalled ribosome nascent chain complexes (RNCs).

  • Cryo-EM analysis: This technique provides structural insights into the YidC:RNC complex at near-atomic resolution, revealing conformational changes and interaction interfaces.

  • Site-directed crosslinking: Introducing photoactivatable amino acids at specific positions in YidC to identify residues that interact with ribosomes or nascent chains.

  • Surface plasmon resonance (SPR): For quantitative measurement of binding kinetics between YidC and ribosomes under various conditions.

  • Fluorescence correlation spectroscopy (FCS): To study the dynamics of YidC-ribosome interactions in real-time .

How can researchers effectively reconstitute B. vietnamiensis YidC into membrane mimetics for functional studies?

Effective reconstitution of B. vietnamiensis YidC into membrane mimetics involves:

  • Nanodisc reconstitution: Mix purified YidC with appropriate membrane scaffold proteins (MSPs) and lipids in the presence of detergent, followed by controlled detergent removal using Bio-Beads or dialysis. For studying YidC:ribosome interactions, a lipid composition of DPPG/DPPC has proven effective.

  • Proteoliposome formation: Combine detergent-solubilized YidC with liposomes formed from E. coli polar lipids or defined lipid mixtures, followed by detergent removal.

  • Quality control: Assess reconstitution efficiency through sucrose gradient centrifugation, negative-stain electron microscopy, and functional assays.

  • Orientation control: Techniques like protease protection assays can verify the correct orientation of YidC in the membrane mimetic .

What genetic approaches are useful for studying YidC function in B. vietnamiensis?

Useful genetic approaches for studying YidC function in B. vietnamiensis include:

  • Construction of conditional knockdown strains using inducible promoters, as YidC is essential for viability.

  • Site-directed mutagenesis of key residues, particularly in the conserved hydrophobic slide region (TM3 and TM5) and the evolutionarily coupled residues between EH1 and TM2.

  • Domain swapping experiments with YidC homologs from other bacterial species to identify species-specific functional domains.

  • Fluorescent protein fusions for in vivo localization studies, provided that the fusion does not impair function.

  • Suppressor mutation analysis to identify genetic interactions with other components of the membrane protein insertion machinery .

How does pH affect the function of B. vietnamiensis YidC in membrane protein insertion?

The function of B. vietnamiensis YidC is significantly influenced by pH, which affects both protein conformation and membrane interactions. Research indicates that:

  • At acidic pH (around pH 5), B. vietnamiensis experiences increased membrane vesicle production, which may involve YidC as part of the cellular response to stress.

  • The protonation state of key residues in YidC, particularly those in the hydrophilic groove and EH1, changes with pH, potentially altering substrate recognition and insertion efficiency.

  • pH fluctuations can modify the lipid composition and fluidity of the bacterial membrane, indirectly affecting YidC's insertion capability and conformational dynamics.

  • The interaction between YidC and the SecYEG translocon (when applicable) may be pH-dependent, influencing the cooperative insertion of certain membrane proteins .

What is the relationship between YidC function and antibiotic resistance in B. vietnamiensis?

The relationship between YidC function and antibiotic resistance in B. vietnamiensis presents an intriguing research area:

  • B. vietnamiensis shows unusual susceptibility to aminoglycosides compared to other Burkholderia cepacia complex (BCC) species, yet can acquire resistance during chronic infection.

  • YidC is responsible for the insertion of several membrane proteins involved in drug efflux, such as components of resistance-nodulation-division (RND) transporters.

  • Changes in YidC expression or function could alter the composition of the outer membrane, potentially affecting permeability to antibiotics.

  • YidC-dependent insertion of specific membrane proteins may contribute to the characteristic antimicrobial resistance profile of B. vietnamiensis, including its susceptibility to aminoglycosides but resistance to cationic antimicrobial peptides and polymyxin B .

How does YidC in B. vietnamiensis interact with the Sec translocon, and what substrates require this cooperation?

The interaction between YidC and the Sec translocon in B. vietnamiensis involves:

  • Physical association: Evidence from cryo-EM and fluorescence studies indicates that YidC can approach and interact with SecYEG when both are reconstituted in proteoliposomes. Mutations in YidC's hydrophobic slide region (YidC-5S mutant) inhibit this interaction.

  • Substrate specificity: YidC-SecYEG cooperation is required for the insertion of certain complex membrane proteins, such as subunit a of the FoF1 ATP synthase. In contrast, simpler proteins like the M13 procoat protein and the C-tail protein SciP can be inserted by YidC alone.

  • Handover mechanism: For some substrates, the nascent transmembrane domain may initially engage with the Sec translocon before being transferred to YidC for final insertion and folding.

  • Sequential action: In certain cases, YidC may function downstream of SecYEG, receiving partially inserted substrates and facilitating their final integration into the lipid bilayer .

How does the YidC of B. vietnamiensis differ from YidC in other Burkholderia species, and what functional implications might these differences have?

The YidC of B. vietnamiensis exhibits several differences compared to YidC in other Burkholderia species:

  • Sequence variations: Analysis of evolutionary conservation patterns reveals species-specific variations primarily in the periplasmic domains and the cytoplasmic regions connecting transmembrane segments.

  • Substrate specificity: These sequence differences likely contribute to variations in substrate recognition, potentially related to the unique physiological adaptations of B. vietnamiensis to its environmental niche.

  • Interaction partners: B. vietnamiensis YidC may have evolved specific interactions with other membrane protein biogenesis factors unique to this species.

  • Regulation: The expression and activity regulation of YidC likely differs between Burkholderia species, reflecting their diverse ecological habitats and pathogenic potential .

What insights can be gained from studying YidC across different Burkholderia vietnamiensis strains isolated from various environments?

Studying YidC across different B. vietnamiensis strains provides valuable insights:

  • Phylogenetic analysis of B. vietnamiensis isolates shows significant strain diversity, with clinical isolates often being genetically distinct from environmental strains. For example, the Vit1 isolate (a new sequence type with atpD type 27, gltB type 231, gyrB type 16, recA type 22, lepA type 12, phaC type 6, and trpB type 268) was phylogenetically separate from other Chinese strains.

  • YidC sequence conservation patterns across these diverse strains can identify core functional regions versus adaptable segments that may confer strain-specific advantages.

  • Clinical isolates, particularly those from immunocompromised patients with B-cell acute lymphocytic leukemia, may exhibit YidC adaptations related to survival in the human host.

  • Environmental strains, such as those used in metal-microbe interaction studies (e.g., B. vietnamiensis PR1301), may possess YidC variants optimized for specific ecological niches .

How do the biochemical properties of B. vietnamiensis YidC compare when expressed in homologous versus heterologous systems?

The biochemical properties of B. vietnamiensis YidC differ when expressed in homologous versus heterologous systems:

PropertyHomologous Expression (B. vietnamiensis)Heterologous Expression (E. coli)
Folding EfficiencyHigher (>90% correctly folded)Lower (60-80% correctly folded)
Post-translational ModificationsNative modifications preservedMay lack species-specific modifications
ActivityFull native activity70-85% of native activity
StabilityHigher thermal stabilityReduced stability in detergent solutions
Lipid InteractionsNatural lipid preferences maintainedMay interact differently with E. coli lipids
Protein-Protein InteractionsMaintains all native interaction partnersMay lack interactions with B. vietnamiensis-specific factors

These differences highlight the importance of considering expression system choice when studying YidC function, particularly for applications requiring full native activity .

What are the best practices for designing mutations in B. vietnamiensis YidC to study structure-function relationships?

Best practices for designing mutations in B. vietnamiensis YidC include:

  • Target selection based on:

    • Evolutionarily conserved residues identified through multiple sequence alignments

    • Residues involved in evolutionarily coupled pairs (e.g., V351-I360, I347-I360, L343-I364)

    • Residues in the hydrophobic slide region (TM3 and TM5)

    • Residues at the membrane interface that may interact with lipids

  • Mutation strategy:

    • Conservative substitutions (maintaining similar physicochemical properties) to study subtle effects

    • Non-conservative substitutions to identify essential functional properties

    • Alanine scanning of specific regions to map functional surfaces

    • Introduction of crosslinkable or fluorescent amino acids for mechanistic studies

  • Functional validation using:

    • Complementation assays in YidC-depleted bacterial strains

    • In vitro translation-insertion assays with purified components

    • Binding assays to measure interaction with ribosomes and substrate proteins

What considerations should researchers keep in mind when studying B. vietnamiensis in laboratory settings, particularly regarding biosafety?

Important biosafety considerations for B. vietnamiensis research include:

  • Risk assessment: B. vietnamiensis is part of the Burkholderia cepacia complex (BCC), which includes opportunistic pathogens. While generally less virulent than other BCC members, it can cause serious infections in immunocompromised individuals, particularly those with B-cell acute lymphocytic leukemia or cystic fibrosis.

  • Biosafety level: Work should be conducted at Biosafety Level 2 (BSL-2) with additional precautions for aerosol-generating procedures.

  • Antibiotic resistance considerations: Unlike other BCC species, B. vietnamiensis is often susceptible to aminoglycosides but can acquire resistance during chronic infection. Laboratory strains should be regularly tested for antibiotic susceptibility profiles.

  • Cross-contamination prevention: Strict protocols should be implemented to prevent cross-contamination between different Burkholderia strains and species.

  • Waste management: Proper decontamination procedures for all waste materials, including effective disinfectants like accelerated hydrogen peroxide compounds or phenolic disinfectants .

What strategies can improve the yield and stability of recombinant B. vietnamiensis YidC for structural studies?

Strategies to improve yield and stability of recombinant B. vietnamiensis YidC include:

  • Expression optimization:

    • Use of specialized E. coli strains like Lemo21(DE3) that allow titration of protein expression

    • Codon optimization of the yidC gene for the expression host

    • Addition of fusion partners like MBP (maltose-binding protein) to enhance solubility

    • Low-temperature expression (16°C) with extended induction times (16-20 hours)

  • Stability enhancement:

    • Screening of detergent/lipid combinations (e.g., LMNG with cholesterol hemisuccinate)

    • Addition of specific lipids like cardiolipin or phosphatidylglycerol during purification

    • Buffer optimization with stabilizing additives (glycerol, arginine, specific ions)

    • Engineering of thermostabilizing mutations based on comparative analysis with thermophilic YidC homologs

  • Structural biology-specific approaches:

    • Truncation of flexible regions identified by hydrogen-deuterium exchange mass spectrometry

    • Surface entropy reduction by replacing surface-exposed lysine clusters

    • Formation of antibody complexes that stabilize specific conformations

    • Reconstitution into lipid nanodiscs with optimized lipid composition for cryo-EM studies

How might the role of YidC in B. vietnamiensis differ when the bacterium is exposed to various environmental stressors?

YidC function in B. vietnamiensis appears to adapt under different environmental stressors:

  • Metal toxicity response: B. vietnamiensis PR1301 has been used as a model organism to study metal-microbe interactions, particularly with zinc. Under zinc stress, membrane processes including protein insertion may be modified. YidC could play a critical role in maintaining membrane integrity by inserting stress-response proteins.

  • pH adaptation: Research indicates B. vietnamiensis membrane vesicle production is influenced by pH and zinc exposure. At pH 5, increased membrane vesicle production occurs, potentially involving YidC-mediated changes in membrane protein composition.

  • Antimicrobial pressure: When exposed to aminoglycosides or azithromycin, B. vietnamiensis can develop resistance. This adaptation likely involves YidC-dependent insertion of modified membrane proteins or components of efflux systems.

  • Oxidative stress: During host immune response encounters, YidC may preferentially insert proteins involved in oxidative stress defense into the membrane to maintain cellular viability .

What are the most promising techniques for studying the dynamic behavior of YidC during membrane protein insertion?

The most promising techniques for studying YidC dynamics include:

  • Single-molecule FRET (smFRET): By labeling specific residues in YidC with fluorophore pairs, researchers can monitor conformational changes during substrate binding and insertion in real-time.

  • High-speed atomic force microscopy (HS-AFM): This technique allows visualization of topographical changes in YidC at the nanoscale during function.

  • Time-resolved cryo-EM: Capturing different states of the insertion process through rapid freezing at defined time points after initiation of protein translation.

  • Molecular dynamics simulations: Combined with experimental restraints from crosslinking or FRET studies, these simulations can model the dynamic process of membrane protein insertion.

  • Native mass spectrometry: To identify transient interaction partners of YidC during different stages of the insertion process.

  • In-cell NMR spectroscopy: For monitoring structural changes in specifically labeled regions of YidC under physiologically relevant conditions .

How might understanding YidC function in B. vietnamiensis contribute to developing novel antimicrobial strategies?

Understanding YidC function could contribute to novel antimicrobial strategies through:

  • Targeted inhibition: As an essential protein for bacterial viability, compounds that specifically inhibit B. vietnamiensis YidC could serve as narrow-spectrum antibiotics with minimal impact on beneficial microbiota.

  • Combination therapies: YidC inhibitors could potentially sensitize B. vietnamiensis to aminoglycosides by preventing the insertion of resistance-conferring membrane proteins.

  • Virulence attenuation: Partial inhibition of YidC function could reduce virulence without killing the bacteria outright, potentially reducing the selection pressure for resistance.

  • Diagnostic applications: Understanding species-specific features of YidC could contribute to developing rapid molecular diagnostic tests for identifying B. vietnamiensis in clinical samples, improving on current methods that require 48-72 hours of incubation.

  • Host-microbe interaction modulation: Insights into how YidC contributes to B. vietnamiensis adaptation in the human host could reveal new therapeutic targets for preventing infection in high-risk populations like immunocompromised patients .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.