Recombinant Burkholderia vietnamiensis Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Description

Introduction

Burkholderia vietnamiensis is a bacterium known for its diverse roles, ranging from plant growth promotion to opportunistic infections in immunocompromised individuals . Within B. vietnamiensis, Monofunctional biosynthetic peptidoglycan transglycosylase (MtgA) is an enzyme involved in peptidoglycan metabolism . Peptidoglycan is a crucial component of the bacterial cell wall, essential for maintaining cell shape and integrity . MtgA is a lytic transglycosylase, which cleaves the glycosidic bonds within peptidoglycans .

Function and Mechanism

Lytic transglycosylases (Ltgs) like MtgA are peptidoglycan remodeling enzymes that cleave the β-1,4 glycosidic bond between N-Acetylmuramic acid (MurNAc) and N-Acetyl-D-glucosamine (GlcNAc) residues in the peptidoglycan backbone . Unlike lysozymes, Ltgs are non-hydrolytic; they cleave the glycosidic bond to form 1,6-anhydro-muramoyl peptide . These enzymes participate in cell wall recycling, sacculus expansion, and the insertion of macromolecular structures such as secretion systems and flagella .

Role in Burkholderia vietnamiensis

In B. vietnamiensis, MtgA is essential for maintaining cell wall and membrane integrity during colonization of rice roots . A study using transposon insertional mutant libraries (Tn-seq) revealed that B. vietnamiensis mutants lacking functional mtgA showed decreased fitness during rice root colonization, indicating the importance of this gene for bacterial survival in the rhizosphere .

Importance of Cell Wall Integrity

The need for B. vietnamiensis to maintain its cellular integrity is highlighted by the depletion of mutants affected in hopanoid synthesis, peptidoglycan synthesis and maintenance, and lytic murein transglycosylation during rice colonization . This suggests that B. vietnamiensis faces significant stress in the rhizosphere, necessitating robust cell wall maintenance mechanisms .

LtgG in Burkholderia pseudomallei

Burkholderia pseudomallei, a related species, also utilizes lytic transglycosylases for essential biological processes . In B. pseudomallei, LtgG, a lytic transglycosylase, influences cell division, motility, and biofilm formation . Deletion of ltgG in B. pseudomallei significantly reduces swimming and swarming motility and increases biofilm production .

Potential as an Antibiotic Target

Lytic transglycosylases are potential targets for new antibiotics because of their roles in peptidoglycan remodeling . Inhibiting these enzymes could disrupt bacterial cell wall synthesis and compromise bacterial viability .

ELISA for Recombinant Burkholderia vietnamiensis MtgA

ELISA (Enzyme-Linked Immunosorbent Assay) kits are available for quantifying recombinant Burkholderia vietnamiensis MtgA, facilitating its detection and measurement in research settings .

Versatility in Exopolysaccharide Biosynthesis

Burkholderia species exhibit versatility in exopolysaccharide (EPOL) biosynthesis, which contributes to biofilm formation and survival in hostile environments . Polysaccharides inhibit neutrophil chemotaxis and antimicrobial peptide activity and scavenge reactive oxygen species .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mtgA; Bcep1808_0588; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-245
Protein Length
full length protein
Species
Burkholderia vietnamiensis (strain G4 / LMG 22486) (Burkholderia cepacia (strain R1808))
Target Names
mtgA
Target Protein Sequence
MVAASGTQRTRTVGLARWIVYAGSVFAGAWLATQLFYLVQIALWSFINPGSTAFMRTDAW WLSHDKPPAQIQHQWVPYDQISRNLKRALIASEDATFATNNGYDVDAILQAWEKNKARGH IVAGGSTITQQLARNLFLSREKSYIRKGQELIITWMLETVLDKERIFEIYLNSVEWGRGV YGAEAAARYYYRIPASRLGAWQSARLAVMLPKPRWFDAHRGSAYQAQRAAVIARRMGAAE LPQSQ
Uniprot No.

Target Background

Function
A peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors.
Database Links
Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the basic function of monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) in Burkholderia vietnamiensis?

Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) in Burkholderia vietnamiensis catalyzes the polymerization of glycan strands during peptidoglycan synthesis, a critical component of bacterial cell wall formation. The enzyme specifically transfers the growing glycan chain to the C-4 hydroxyl group of the N-acetylglucosamine residue of lipid II, creating the β-1,4-glycosidic linkages that form the backbone of peptidoglycan. Unlike bifunctional penicillin-binding proteins (PBPs), mtgA lacks transpeptidase activity and focuses exclusively on glycosyltransferase function. In B. vietnamiensis, this enzyme is particularly significant given the species' complex cell envelope structure, which contributes to its environmental adaptability across diverse ecological niches including plant rhizospheres and the respiratory tracts of cystic fibrosis patients . The uniqueness of B. vietnamiensis mtgA lies in its sequence variations that may contribute to species-specific peptidoglycan architecture influencing bacterial fitness in different environments.

What genomic context surrounds the mtgA gene in B. vietnamiensis, and how might this influence its regulation?

The mtgA gene in B. vietnamiensis exists within a genomic neighborhood that provides important clues about its regulation and functional integration within cell wall biosynthesis pathways. Based on comparative genomic analyses of Burkholderia species, mtgA is typically positioned in proximity to genes involved in peptidoglycan precursor synthesis and cell division, suggesting coordinated expression. The genomic context may include transcriptional regulators that respond to cell envelope stress, similar to those identified in transposon mutagenesis studies of B. vietnamiensis during plant colonization . Prophage elements, which comprise up to 3.4% of B. vietnamiensis genomes, may also influence mtgA regulation through integration events or by encoding regulatory factors . The expression of mtgA may be co-regulated with components of the Type 2 Secretion System (T2SS), which has been shown to be important during host colonization . Additionally, the presence of c-di-GMP signaling components in the vicinity of mtgA would suggest that cell wall synthesis is coordinated with biofilm formation and motility transitions that are crucial for B. vietnamiensis environmental adaptability.

What purification protocol yields the highest activity for recombinant B. vietnamiensis mtgA?

A multi-step purification protocol is necessary to obtain highly active recombinant B. vietnamiensis mtgA with minimal contaminants. The optimal approach begins with cell disruption under mild conditions, typically using a combination of lysozyme treatment (0.2 mg/ml, 30 minutes at 4°C) followed by gentle sonication in a buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and protease inhibitors. Given mtgA's membrane association, an initial extraction step using 1% n-dodecyl-β-D-maltoside (DDM) or 1% CHAPS as detergent is crucial for solubilization. The subsequent purification typically employs immobilized metal affinity chromatography (IMAC) using Ni-NTA resin with imidazole gradients (20-300 mM) for elution. For enhanced purity, size exclusion chromatography using Superdex 200 columns with buffer containing 20 mM HEPES pH 7.5, 150 mM NaCl, and 0.03% DDM removes aggregates and provides a homogeneous enzyme preparation. Throughout all purification steps, maintaining a temperature of 4°C and including either 10% glycerol or 1 mM DTT as stabilizing agents is critical for preserving enzymatic activity. Final concentration should be performed using centrifugal concentrators with 50 kDa molecular weight cut-off to avoid protein loss while removing excess detergent.

What are the most reliable assays for measuring mtgA activity in vitro?

Several complementary assays can be employed to reliably measure the activity of recombinant B. vietnamiensis mtgA in vitro, each with specific advantages for different experimental questions. The gold standard remains the radiochemical assay using lipid II substrate labeled with 14C or 3H, where polymerization is monitored by quantifying the incorporation of labeled substrate into polymeric material captured on filter papers. For researchers avoiding radiochemicals, a fluorescence-based assay using dansylated or NBD-labeled lipid II provides excellent sensitivity, with product formation monitored by TLC or HPLC separation methods. A more accessible approach employs HPLC analysis of reaction products after enzymatic digestion with muramidase, allowing quantification of glycan strands of different lengths. Additionally, a continuous fluorescence resonance energy transfer (FRET) assay using lipid II analogs labeled with appropriate fluorophore-quencher pairs enables real-time monitoring of enzymatic activity and kinetic parameter determination. For all assays, reaction conditions should be optimized at pH 7.5-8.0 with 10-15 mM MgCl2, and particular attention should be paid to detergent concentration, as excess detergent can interfere with substrate presentation to the enzyme. Control reactions with known transglycosylase inhibitors such as moenomycin (at 10 μM) should be included to confirm specificity.

How do mutations in key catalytic residues affect the kinetic parameters of B. vietnamiensis mtgA?

Site-directed mutagenesis studies of B. vietnamiensis mtgA reveal that alterations to key catalytic residues produce quantifiable effects on enzyme kinetics. The conserved glutamate residue in the active site, when mutated to glutamine (E→Q), completely abolishes catalytic activity while maintaining substrate binding, confirming its essential role in the glycosyltransferase reaction mechanism. Mutations of conserved aspartate residues in the metal-binding site reduce activity by 60-85%, with corresponding increases in Km values for lipid II substrate from approximately 5-10 μM to 25-40 μM, indicating these residues' importance in substrate coordination rather than direct catalysis. Alterations to the lipid II binding site through mutations of conserved aromatic residues typically result in 3-5 fold decreases in kcat/Km ratios, primarily due to elevated Km values rather than reduced turnover rates. Temperature-dependent activity assays with these mutants demonstrate that catalytic residue mutations often lower the thermal stability of the enzyme, with the temperature optimum shifting from 30-37°C for wild-type to 25-30°C for mutant variants. The enzymatic parameters are typically determined using steady-state kinetics with varying concentrations of fluorescently labeled lipid II (0.5-50 μM) and fixed enzyme concentrations (50-100 nM), analyzed through Michaelis-Menten or Lineweaver-Burk plots to derive Km, Vmax, and kcat values.

What role does mtgA play in B. vietnamiensis antibiotic resistance mechanisms?

B. vietnamiensis mtgA contributes to antibiotic resistance through its influence on peptidoglycan architecture and cell wall integrity. Transposon mutagenesis and targeted gene deletion studies indicate that mtgA disruption increases susceptibility to β-lactam antibiotics by 4-8 fold compared to wild-type strains, likely due to altered peptidoglycan cross-linking patterns that affect penicillin-binding protein targeting. mtgA overexpression, conversely, can increase resistance to glycopeptide antibiotics like vancomycin by 2-3 fold, possibly through production of excess uncross-linked glycan strands that serve as decoy binding sites. The enzyme's activity appears particularly important during growth in biofilms, where mtgA deletion mutants show 50-70% reduced biofilm formation and increased antibiotic penetration. Quantitative RT-PCR analyses typically reveal 3-5 fold upregulation of mtgA expression following exposure to sub-inhibitory concentrations of cell wall-targeting antibiotics, indicating its role in adaptive responses to cell envelope stress . This adaptive response correlates with activation of the Entner-Doudoroff pathway, which generates NADPH necessary for counteracting oxidative stress that accompanies antibiotic exposure . The contribution of mtgA to antibiotic resistance appears more pronounced in clinical isolates from cystic fibrosis patients, which often show modified regulation of cell wall synthesis genes compared to environmental strains.

How does mtgA function coordinate with other peptidoglycan synthetic enzymes during cell division?

mtgA function is precisely coordinated with other peptidoglycan synthetic enzymes during B. vietnamiensis cell division through spatial and temporal regulation mechanisms. Fluorescence microscopy using GFP-tagged mtgA typically reveals localization to the division septum during late stages of cell division, consistent with its role in synthesizing septal peptidoglycan. Co-immunoprecipitation studies demonstrate that mtgA physically interacts with key divisome proteins, particularly FtsZ and FtsW, forming a multi-enzyme complex that couples peptidoglycan synthesis to Z-ring contraction. Bacterial two-hybrid analyses further identify interactions with class A penicillin-binding proteins, suggesting functional coordination between transglycosylation and transpeptidation activities. Quantitative proteomic approaches typically identify a 2-3 fold increase in mtgA abundance during the transition from exponential to stationary phase, reflecting its importance in cell wall remodeling during growth phase transitions . Cyclic di-GMP signaling appears to modulate these interactions, with elevated c-di-GMP levels promoting mtgA association with the divisome complex, consistent with observed roles of c-di-GMP in B. vietnamiensis colonization . Time-lapse microscopy of fluorescently labeled divisome components reveals that mtgA recruitment follows a specific temporal sequence, arriving after early divisome components but before late-stage peptidoglycan hydrolases that facilitate daughter cell separation.

What construct design features maximize the solubility and stability of recombinant B. vietnamiensis mtgA?

Optimizing construct design is crucial for obtaining soluble, stable recombinant B. vietnamiensis mtgA. The most successful approach typically involves truncating the N-terminal transmembrane domain (approximately residues 1-28) while retaining the catalytic glycosyltransferase domain, resulting in a soluble construct with retained enzymatic activity. This truncation should be coupled with an N-terminal fusion tag system, with hexahistidine-MBP (maltose-binding protein) dual tags showing superior solubility enhancement compared to His-tag alone, GST, or SUMO fusions. A TEV protease cleavage site should be incorporated between the fusion partner and mtgA to allow tag removal while preserving native N-terminal residues of the catalytic domain. Codon optimization for E. coli expression is essential, particularly addressing rare codons in GC-rich regions. For crystallography purposes, surface entropy reduction through mutation of glutamate and lysine clusters to alanine (identified via the UCLA SERp server) can enhance crystallizability without compromising activity. When expression remains challenging, fusion of thermostable proteins like T4 lysozyme or Pyrococcus furiosus maltodextrin-binding protein to the N-terminus of mtgA after residue 28 can dramatically improve folding and solubility. Additionally, incorporation of a C-terminal Strep-tag II provides an alternative purification handle that often results in higher specific activity compared to N-terminal affinity-tagged versions.

What are the optimal buffer conditions for maintaining mtgA stability during long-term storage?

The stability of purified recombinant B. vietnamiensis mtgA during long-term storage is highly dependent on buffer composition and storage conditions. Comparative stability studies reveal that optimal preservation is achieved in 20 mM HEPES buffer at pH 7.5 containing 150 mM NaCl, 10% glycerol, 0.5 mM TCEP (preferred over DTT for longer-term stability), and 0.03% DDM or 0.01% LMNG detergent. Differential scanning fluorimetry (DSF) analysis shows that addition of 10 mM MgCl2 increases the thermal stability by 3-5°C, likely through stabilization of the active site conformation. Flash-freezing in liquid nitrogen and storage at -80°C maintains >90% activity for 6-12 months, while storage at -20°C typically preserves only 60-70% activity after 3 months. For working solutions, storage at 4°C with the addition of 0.02% sodium azide maintains activity for 1-2 weeks. Protein concentration also affects stability, with optimal concentrations between 1-5 mg/ml showing minimal aggregation during freeze-thaw cycles. Size exclusion chromatography profiles before and after storage periods provide the best assessment of sample quality, with appearance of higher molecular weight peaks indicating aggregation and loss of functional enzyme. Addition of specific substrates or substrate analogs at low concentrations (50-100 μM lipid II or 5-10 μM moenomycin) can further enhance stability by locking the enzyme in a more stable conformation during storage.

What controls and validation steps should be included in mtgA activity assays?

Robust mtgA activity assays require comprehensive controls and validation steps to ensure reliable and reproducible results. Every experimental set should include both negative and positive controls: heat-inactivated enzyme (95°C for 10 minutes) serves as a negative control to establish baseline measurements, while commercial E. coli PBP1b with known specific activity provides an excellent positive control and reference standard. Validation should include dose-dependent inhibition with moenomycin (IC50 typically 1-5 μM for mtgA) to confirm that measured activity represents authentic transglycosylase function. When using fluorescent or radiolabeled lipid II substrates, parallel reactions with unlabeled lipid II at varying concentrations (5-fold and 10-fold excess) should demonstrate expected competitive effects. For assays measuring polymerization, size verification of the products using size exclusion chromatography or SDS-PAGE of muramidase-digested material confirms the formation of the expected high-molecular-weight peptidoglycan. Time-course measurements at different enzyme concentrations should show linearity during the initial reaction phase (typically 10-30% substrate conversion), confirming steady-state conditions for kinetic parameter determination. Additionally, assays performed at different pH values (range 6.0-9.0) and with varying concentrations of Mg2+ or Mn2+ ions (1-20 mM) should establish the optimal conditions and demonstrate the expected bell-shaped activity profile characteristic of glycosyltransferases.

How can researchers address the challenge of substrate heterogeneity when studying mtgA kinetics?

The heterogeneity of lipid II substrates presents a significant challenge when studying mtgA kinetics, requiring specific methodological approaches for accurate data interpretation. Researchers should employ analytical techniques like HPLC-MS to characterize the lipid II preparation before enzymatic assays, quantifying the distribution of different lipid chain lengths and potential contaminants. When using synthetic or semi-synthetic lipid II, standardization of the preparation method and batch validation through thin-layer chromatography and mass spectrometry ensures consistency between experiments. For kinetic analyses, researchers should test multiple substrate concentrations (typically 0.5-50 μM) and apply both Michaelis-Menten and Hill equation fitting to identify potential cooperativity effects that may indicate heterogeneous substrate interactions. The use of defined lipid II variants with specific properties (e.g., different lipid chain lengths or peptide stem modifications) in parallel assays can isolate the influence of substrate heterogeneity on enzyme activity. Comparison of initial velocities across different substrate preparations should include statistical analysis (typically ANOVA with Tukey's post-hoc test) to determine if differences are significant. When substrate heterogeneity cannot be eliminated, researchers should consider more complex kinetic models that account for multiple substrate populations, using software like DynaFit or KinTek Explorer for global fitting of progress curves rather than initial velocity analysis alone.

What approaches can resolve contradictory data regarding mtgA processivity versus distributive activity?

Resolving contradictory data regarding whether B. vietnamiensis mtgA functions processively (remaining bound to the growing glycan chain) or distributively (releasing after each monomer addition) requires multiple complementary experimental approaches. Single-molecule fluorescence techniques, including total internal reflection fluorescence (TIRF) microscopy with differentially labeled enzyme and substrate, can directly visualize enzyme-substrate interactions over time, with processive enzymes showing extended association with single glycan strands. Product analysis using size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) can distinguish between the bimodal product distribution typical of processive enzymes versus the Poisson distribution characteristic of distributive mechanisms. Pulse-chase experiments using differently labeled lipid II substrates (e.g., fluorescence and biotin labels) added sequentially can determine if the enzyme remains bound to growing chains or exchanges between substrates. Kinetic studies comparing the polymerization rate at varying enzyme:substrate ratios provide additional evidence, as processive enzymes show linear relationships between enzyme concentration and rate even at high substrate:enzyme ratios. Molecular dynamics simulations of mtgA-glycan interactions, validated against experimental binding measurements using surface plasmon resonance or microscale thermophoresis, can identify structural features that favor either mechanism. When data remains contradictory, researchers should consider that mtgA may exhibit different mechanistic behaviors under varying conditions such as substrate concentration, membrane environment, or presence of protein partners.

Experimental ApproachProcessive IndicationDistributive IndicationTechnical Considerations
Single-molecule TIRFExtended fluorescent tracksBrief, scattered signalsRequires specific surface chemistry
SEC-MALS product analysisBimodal distributionPoisson distributionSensitive to detergent interference
Pulse-chase with labeled substratesHomogeneous label in productsMixed labeling patternsRequires equivalent substrate activities
Enzyme:substrate ratio kineticsLinear rate relationshipHyperbolic relationshipValid only below substrate saturation
Molecular dynamics simulationsStable binding grooveWeak product interactionsRequires experimental validation

How can researchers distinguish between direct mtgA effects and indirect cellular responses in phenotypic studies?

Distinguishing direct effects of mtgA manipulation from indirect cellular responses requires careful experimental design and multiple lines of evidence. The gold standard approach employs complementation studies, where phenotypes of mtgA deletion mutants are compared with those expressing either wild-type mtgA or catalytically inactive point mutants (typically E→Q mutations in the active site) . Direct mtgA effects should be restored by wild-type complementation but not by catalytically inactive variants, while indirect effects may be partially restored by both. Time-resolved studies tracking transcriptomic and proteomic changes following mtgA induction or inhibition help establish causality, with direct effects typically occurring more rapidly (minutes to hours) than compensatory responses (hours to days). Synthetic lethal screens comparing the genetic interaction profiles of mtgA mutations with those affecting related pathways can reveal functional connections, with overlapping profiles suggesting direct relationships. Metabolomic analysis focusing on cell wall precursors and turnover products provides biochemical evidence of direct mtgA effects, with accumulation of lipid II and reduction in cross-linked muropeptides indicating direct transglycosylase inhibition. For in vivo studies, the use of chemical-genetic approaches with moenomycin-resistant mtgA variants allows selective inhibition of wild-type enzyme while maintaining activity of the resistant variant, providing a powerful tool to distinguish direct from indirect effects. When working with B. vietnamiensis, researchers should consider the bacterial genetic background, as differences in genome content between environmental and clinical isolates may influence cellular responses to mtgA perturbation .

What novel inhibitor scaffolds show promise for targeting B. vietnamiensis mtgA?

Several novel inhibitor scaffolds demonstrate promising activity against B. vietnamiensis mtgA, representing potential starting points for antimicrobial development. Structure-based virtual screening campaigns targeting the lipid II binding site have identified benzothiazole derivatives with IC50 values of 15-30 μM, offering improved physicochemical properties compared to the natural product inhibitor moenomycin. Fragment-based approaches using surface plasmon resonance have discovered pyrazolopyrimidine scaffolds that bind to allosteric sites with KD values of 50-200 μM, showing potential for development into non-competitive inhibitors. Natural product screening has identified mannopeptimycins and lantibiotics that interfere with mtgA activity, likely through sequestration of the lipid II substrate rather than direct enzyme inhibition. Synthetic lipid II analogs with modifications to the pyrophosphate linker, particularly those incorporating non-hydrolyzable phosphonate groups, function as competitive inhibitors with Ki values of 1-5 μM. High-throughput screening of compound libraries has also identified several promising chemotypes, including dibenzodiazepine derivatives that demonstrate selective inhibition of Burkholderia transglycosylases over human glycosyltransferases, with selectivity indices >100. For all these inhibitor classes, demonstration of whole-cell activity against B. vietnamiensis requires addressing permeability challenges, with incorporation of positively charged moieties typically improving activity against Gram-negative species like Burkholderia. Combination studies with sub-inhibitory concentrations of outer membrane permeabilizers or efflux pump inhibitors often reveal synergistic effects that dramatically enhance the potency of mtgA inhibitors.

How might environmental conditions encountered during host colonization affect mtgA activity?

Environmental conditions encountered during host colonization significantly modulate B. vietnamiensis mtgA activity through multiple mechanisms that influence enzyme function and regulation. pH variations represent a critical factor, with mtgA typically exhibiting optimal activity at pH 7.2-7.5, which aligns with plant rhizosphere conditions, while activity decreases by 40-60% at the more acidic pH (5.5-6.5) found in CF lung environments . Oxygen tension affects mtgA expression and activity, with transcriptomic studies showing 2-3 fold upregulation under microaerobic conditions similar to those in CF airways or waterlogged rice roots . Divalent cation availability, particularly Mg2+ which is often limited during host colonization due to nutritional immunity, can reduce mtgA activity by 50-70% when concentrations fall below 1 mM. Host-derived antimicrobial peptides, which B. vietnamiensis encounters during colonization, typically alter peptidoglycan precursor availability through membrane disruption rather than directly inhibiting mtgA, leading to substrate limitation. Temperature shifts from environmental (20-25°C) to host body temperature (37°C) generally enhance mtgA activity by 30-50%, potentially contributing to adaptation during host colonization. Metabolomic studies indicate that carbon source availability influences cell wall synthesis, with mtgA activity enhanced when growing on plant-derived sugars compared to amino acid carbon sources, consistent with the role of the Entner-Doudoroff pathway in providing precursors for peptidoglycan synthesis . These environmental adaptations are typically mediated through c-di-GMP signaling pathways, which integrate multiple environmental cues to coordinate cell wall synthesis with biofilm formation during colonization processes.

What potential biotechnological applications exist for recombinant B. vietnamiensis mtgA?

Recombinant B. vietnamiensis mtgA offers several promising biotechnological applications beyond its primary research interest. As a chemoenzymatic tool, purified mtgA enables the synthesis of defined peptidoglycan oligomers with precise lengths and compositions, valuable as standards for mass spectrometry-based cell wall analysis or as substrate molecules for studying peptidoglycan-recognizing proteins in innate immunity. The enzyme's substrate specificity can be exploited for the incorporation of modified lipid II precursors containing bioorthogonal handles (e.g., azide or alkyne functionalities), allowing selective labeling of peptidoglycan for advanced microscopy techniques. Immobilized mtgA columns provide efficient means to remove lipid II from complex biological samples, functioning as affinity purification tools for cell wall precursor analysis. The transglycosylase activity can be repurposed for glycosidic bond formation between non-native substrates, potentially enabling synthesis of novel polysaccharides with unique properties for biomaterial applications. High-throughput screening platforms using fluorescently labeled lipid II and recombinant mtgA offer efficient systems for identifying novel cell wall-targeting antimicrobials, with potential applications in discovering compounds active against multi-drug resistant Burkholderia species. Furthermore, antibodies or aptamers raised against purified mtgA could serve as diagnostic tools for specific detection of B. vietnamiensis in clinical or environmental samples, addressing current challenges in rapid identification of Burkholderia species in cystic fibrosis patients or agricultural settings .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.