Recombinant Burkholderia vietnamiensis NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Burkholderia vietnamiensis NADH-Quinone Oxidoreductase Subunit A (nuoA)

Recombinant Burkholderia vietnamiensis NADH-quinone oxidoreductase subunit A (nuoA) is a bacterial membrane protein expressed in engineered systems, typically E. coli, for research and biotechnological applications. It is a component of the NADH dehydrogenase I (NDH-1) complex, which facilitates electron transfer from NADH to quinones during aerobic respiration, coupling this process to proton translocation across the inner membrane . The recombinant form retains structural and functional features of the native protein, making it a critical tool for studying bacterial respiratory pathways, enzyme kinetics, and pathogenicity mechanisms in Burkholderia species.

Protein Properties

PropertyValue/Description
Uniprot IDA4JGD0
Gene NamenuoA
Protein Length119 amino acids (full-length)
Expression HostE. coli
TagN-terminal His-tag
Molecular Weight13.4 kDa (predicted)
Subcellular LocationInner membrane

The protein contains a His-tag for purification and is lyophilized in a Tris/PBS-based buffer with trehalose stabilizers . Its sequence begins with MNLAAYYPVLLFLLVGTGLGIALVSIGKLLGPNKPDVEKNAPYECGFEAFEDARMKFDVR..., with conserved motifs critical for quinone binding and proton translocation .

Production and Purity

Recombinant nuoA is expressed in E. coli and purified via affinity chromatography. Suppliers report >90% purity by SDS-PAGE, with a typical yield of 50 µg per vial . Key steps include:

  1. Cloning: Insertion of the nuoA gene into a plasmid vector.

  2. Induction: Expression triggered by IPTG in E. coli.

  3. Purification: His-tagged protein captured via nickel affinity columns.

  4. Lyophilization: Stabilized in trehalose-containing buffers to prevent degradation .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; Bcep1808_2334; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Burkholderia vietnamiensis (strain G4 / LMG 22486) (Burkholderia cepacia (strain R1808))
Target Names
nuoA
Target Protein Sequence
MNLAAYYPVLLFLLVGTGLGIALVSIGKLLGPNKPDVDKNAPYECGFEAFEDARMKFDVR YYLVAILFIIFDLETAFLFPWGVALRDIGWPGFSAMMIFLLEFLLGFAYIWKKGGLDWE
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers. In this species, ubiquinone is the presumed immediate electron acceptor. The enzyme couples this redox reaction to proton translocation; four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred, thus conserving redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Burkholderia vietnamiensis and what is the ecological significance of this organism?

Burkholderia vietnamiensis is a bacterial species belonging to the Burkholderia cepacia complex (BCC). It occupies a unique ecological niche as it can function both as a plant growth-promoting bacterium and as an opportunistic human pathogen. B. vietnamiensis is primarily recognized as the first validated nitrogen-fixing species within the Burkholderia genus . The bacterium was initially isolated from the rhizosphere of rice plants grown in Vietnamese soil and has since been found to colonize various plant hosts including rice (Oryza sativa subspecies japonica and indica), maize, and coffee plants in geographically diverse regions .

The ecological significance of B. vietnamiensis lies in its ability to:

  • Fix atmospheric nitrogen in association with plant roots

  • Promote plant growth through various mechanisms

  • Adapt to different plant hosts with specific genetic strategies

While beneficial in agricultural contexts, B. vietnamiensis can also act as an opportunistic pathogen in immunocompromised individuals, particularly patients with cystic fibrosis .

What is NADH-quinone oxidoreductase and what is the specific role of subunit A?

NADH-quinone oxidoreductase (NUO) is a membrane-associated enzyme complex that catalyzes the oxidation of NADH to NAD+, transferring electrons to quinones in the respiratory chain. In Burkholderia species, this enzyme plays a crucial role in energy metabolism.

The specific role of subunit A (nuoA) in Burkholderia vietnamiensis involves:

  • Contributing to the structural integrity of the membrane-embedded portion of the enzyme complex

  • Participating in the formation of proton translocation channels

  • Supporting the coupling mechanism that links electron transfer to ion transport across the membrane

Unlike the NADH-quinone oxidoreductase from Vibrio cholerae (Na+-NQR), which functions as a sodium pump , the B. vietnamiensis NUO complex is thought to primarily transport protons, although complete characterization of its ion specificity requires further research.

How can recombinant B. vietnamiensis NADH-quinone oxidoreductase subunit A be effectively expressed and purified?

Effective expression and purification of recombinant B. vietnamiensis NADH-quinone oxidoreductase subunit A (nuoA) requires careful optimization of several parameters. Based on established protocols for similar membrane proteins, the following methodology is recommended:

Expression system optimization:

  • Select an appropriate expression vector containing a promoter system that allows tight regulation (such as the P(BAD) promoter used for the nqr operon in V. cholerae)

  • Design the construct with a His-tag, preferably at the N-terminus of the protein

  • Express in E. coli expression systems optimized for membrane proteins (e.g., C41(DE3) or C43(DE3) strains)

Expression conditions:

  • Culture temperature: 30°C for initial growth, reduced to 16-18°C post-induction

  • Induction parameters: 0.5-1.0 mM IPTG (or appropriate inducer)

  • Duration: 4-6 hours post-induction at reduced temperature

Purification protocol:

  • Cell disruption via sonication or French press in buffer containing protease inhibitors

  • Membrane fraction isolation through differential centrifugation

  • Membrane protein solubilization using appropriate detergents (dodecyl maltoside has been successfully used for related NADH-quinone oxidoreductases)

  • Affinity chromatography using Ni-NTA resin

  • Size exclusion chromatography for further purification

The choice of detergent is critical as it affects enzyme activity and cofactor retention. For instance, with the related Na+-NQR from V. cholerae, dodecyl maltoside (DM) preserved ubiquinone binding, while LDAO resulted in negligible quinone content .

What are the established methods for detecting and characterizing B. vietnamiensis and its associated proteins in environmental or clinical samples?

Several established methodologies exist for detecting and characterizing B. vietnamiensis and its associated proteins in environmental or clinical samples:

Molecular detection methods:

  • 16S rRNA gene amplification: PCR-based amplification of the 16S rRNA gene followed by sequence analysis can identify B. vietnamiensis, though this may be insufficient to discriminate between closely related BCC species

  • Recombinase-aided amplification (RAA) assay: A rapid method targeting the 16S rRNA gene, demonstrating 100% sensitivity and 98.5% specificity for BCC detection with results available in 10 minutes

  • recA gene analysis: RFLP analysis of PCR-amplified recA demonstrates sufficient nucleotide sequence variation to enable separation of all five B. cepacia complex genomovars, including B. vietnamiensis

  • Multilocus sequence typing (MLST): Analysis of multiple housekeeping genes provides higher resolution for species identification:

    • atpD, gltB, gyrB, recA, lepA, phaC, and trpB typing can be used to assign sequence types

Protein characterization methods:

  • SDS-PAGE: For resolving subunits of multi-component enzymes like NADH-quinone oxidoreductase

  • Western blotting: Using specific antibodies against nuoA or other subunits

  • Activity assays: Measuring NADH oxidation rates spectrophotometrically

  • Mass spectrometry: For protein identification and post-translational modification analysis

Table 1: Comparison of B. vietnamiensis Detection Methods

MethodTime RequiredSensitivitySpecificityAdvantagesLimitations
16S rRNA PCR2-3 hoursModerateModerateWidely used standardInsufficient discrimination between closely related BCC species
RAA assay10 minutesHigh (10 copies/reaction)98.5%Rapid results, high sensitivityRequires specific equipment
recA gene analysis4-5 hoursHighHighDifferentiates all BCC speciesMore complex procedure
MLST1-2 daysHighHighHighest resolution for strain typingLabor intensive, expensive

For specific identification of nuoA protein, mass spectrometry-based proteomics approaches following immunoprecipitation or affinity purification provide the most specific detection in complex biological samples.

What is the relationship between NADH-quinone oxidoreductase function and B. vietnamiensis pathogenicity or plant colonization capabilities?

The relationship between NADH-quinone oxidoreductase function and B. vietnamiensis pathogenicity or plant colonization capabilities represents a complex interplay of bioenergetics, metabolism, and host interaction:

Energy metabolism and colonization:
NADH-quinone oxidoreductase plays a critical role in bacterial energy metabolism, generating the proton motive force necessary for ATP synthesis. During plant root colonization, B. vietnamiensis faces varying oxygen levels and nutrient availability, requiring metabolic flexibility. Transposon sequencing (Tn-seq) studies have identified numerous genes involved in rice root colonization by B. vietnamiensis, with approximately 1,404 genes showing significant impact on fitness during colonization . While specific roles of NADH-quinone oxidoreductase subunits were not directly addressed in these studies, the importance of energy metabolism during colonization is evident.

Role in pathogenicity:
As an opportunistic pathogen in cystic fibrosis patients, B. vietnamiensis must adapt to the host environment. Several factors may link NADH-quinone oxidoreductase to pathogenicity:

  • Adaptation to low oxygen conditions: In the CF lung, bacteria often encounter microaerobic conditions, potentially requiring altered respiratory chain function.

  • Antimicrobial resistance: B. vietnamiensis shows intrinsic susceptibility to aminoglycosides (unlike other BCC species) but can develop resistance during chronic infection . Energy-dependent efflux pumps contribute to antimicrobial resistance, and their function depends on the proton motive force generated partly by respiratory complexes like NADH-quinone oxidoreductase.

  • Virulence factor expression: The expression of virulence factors, including the non-ribosomal peptide synthetase (NRPS) system that produces hemolytic compounds in B. vietnamiensis , may be regulated in response to energy status, implicating respiratory complexes in virulence control circuits.

Host-specific genetic strategies:
Comparative genomic studies have shown that B. vietnamiensis employs distinct genetic strategies when colonizing different rice varieties (japonica vs. indica) , suggesting host-specific adaptation mechanisms. These differential strategies likely involve metabolic adjustments where NADH-quinone oxidoreductase function may be implicated, although direct evidence for its role in host-specific adaptation requires further investigation.

How can I design experiments to investigate the role of nuoA in B. vietnamiensis bioenergetics and host interaction?

Designing experiments to investigate the role of nuoA in B. vietnamiensis bioenergetics and host interaction requires a multifaceted approach:

Genetic manipulation strategies:

  • Gene deletion/disruption: Generate nuoA knockout mutants using suicide vectors similar to approaches used for other Burkholderia genes . Consider:

    • Single-crossover insertion inactivation

    • Double-crossover allelic exchange for complete deletion

    • Conditional mutants using inducible promoters (e.g., rhamnose-inducible system)

  • Complementation studies: Restore the wild-type phenotype by expressing nuoA in trans from a plasmid to confirm phenotypic changes are directly attributable to nuoA loss.

  • Site-directed mutagenesis: Introduce specific amino acid changes to investigate structure-function relationships in nuoA.

Functional characterization experiments:

  • Growth phenotyping: Compare growth rates of wild-type and nuoA mutants under various conditions:

    • Different carbon sources

    • Oxygen availability (aerobic, microaerobic, anaerobic)

    • Various stress conditions (pH, temperature, osmotic stress)

  • Membrane potential measurement: Use fluorescent dyes (e.g., DiSC3(5)) to assess changes in membrane potential in nuoA mutants.

  • Respiratory chain function: Measure NADH oxidation rates and oxygen consumption in membrane vesicles from wild-type and mutant strains.

  • ATP synthesis: Determine ATP levels and synthesis rates to assess bioenergetic consequences of nuoA disruption.

Host interaction studies:

  • Plant colonization assays:

    • Inoculate rice plants (both japonica and indica varieties) with wild-type and nuoA mutants

    • Quantify colonization by plating serial dilutions of homogenized plant tissues

    • Use fluorescently tagged strains for microscopic visualization of colonization patterns

  • Transposon sequencing (Tn-seq): Compare the contribution of different genes to fitness during root colonization in wild-type versus nuoA mutant backgrounds to identify genetic interactions .

  • Infection models:

    • Use Galleria mellonella larvae as an invertebrate infection model

    • Assess virulence of nuoA mutants in relevant cell culture models

    • Monitor changes in antibiotic susceptibility profiles

Protein-protein interaction studies:

  • Co-immunoprecipitation: Identify interaction partners of nuoA within the NADH-quinone oxidoreductase complex and potentially with other cellular components.

  • Bacterial two-hybrid assays: Systematically map interactions between nuoA and other subunits.

  • Cross-linking studies: Use chemical cross-linking followed by mass spectrometry to identify spatial relationships within the complex.

What are the key considerations when analyzing the contribution of nuoA to aminoglycoside susceptibility in B. vietnamiensis?

Analyzing the contribution of nuoA to aminoglycoside susceptibility in B. vietnamiensis requires careful consideration of several factors, as B. vietnamiensis displays unique antibiotic susceptibility profiles compared to other BCC species:

Experimental design considerations:

  • Strain selection and validation:

    • Use multiple B. vietnamiensis clinical and environmental isolates to account for strain variability

    • Include both aminoglycoside-susceptible and resistant strains

    • Verify species identity through recA gene analysis or MLST

    • Include appropriate control strains (other BCC species with intrinsic aminoglycoside resistance)

  • Susceptibility testing methodologies:

    • Perform standardized broth microdilution assays following CLSI guidelines

    • Determine MICs for multiple aminoglycosides (tobramycin, gentamicin, amikacin)

    • Include time-kill kinetics to assess the rate of bacterial killing

    • Evaluate susceptibility under various growth conditions that may affect respiratory chain function

  • Membrane potential and aminoglycoside uptake:

    • Assess membrane potential using fluorescent probes (DiSC3(5))

    • Measure aminoglycoside uptake using radiolabeled antibiotics or fluorescently labeled derivatives

    • Use protonophores like CCCP as controls for membrane potential disruption

    • Employ NPN uptake assays to measure outer membrane permeability changes

Genetic manipulation approaches:

  • nuoA gene knockout and complementation:

    • Generate nuoA deletion mutants in aminoglycoside-susceptible B. vietnamiensis strains

    • Complement with wild-type nuoA expressed from a plasmid

    • Create site-directed mutants in conserved residues of nuoA

  • Gene expression analysis:

    • Monitor expression of nuoA and other respiratory complex genes under antibiotic pressure

    • Compare expression profiles between susceptible and resistant isolates

    • Analyze global transcriptomic changes in nuoA mutants to identify compensatory mechanisms

Mechanistic investigations:

  • Respiratory chain function analysis:

    • Measure NADH-quinone oxidoreductase activity in membrane preparations

    • Assess respiratory rates in intact cells and membrane vesicles

    • Determine if aminoglycoside treatment affects electron transport chain function

  • Adaptive resistance development:

    • Examine acquisition of aminoglycoside resistance in wild-type versus nuoA mutants

    • Induce resistance through serial passage with subinhibitory concentrations of tobramycin or azithromycin

    • Sequence nuoA and related genes in pre- and post-adaptation isolates

Table 2: Experimental Approaches for Investigating nuoA Contribution to Aminoglycoside Susceptibility

ApproachKey ParametersExpected OutcomesLimitations
MIC determinationConcentration range, medium composition, incubation timeQuantitative measure of susceptibility changes in nuoA mutantsMay not reveal mechanism of action
Membrane potential measurementProbe selection, cell density, calibrationDirect assessment of nuoA's role in maintaining membrane potentialPotential artifacts from fluorescent probes
Aminoglycoside uptakeAntibiotic concentration, time points, separation methodCorrelation between nuoA function and drug accumulationTechnical challenges with quantification
Gene expression analysisGrowth conditions, RNA extraction method, normalizationRegulatory networks affected by nuoA disruptionExpression changes may be indirect
Adaptive resistanceSelection pressure, passage number, stability testingRate of resistance development in nuoA mutants vs. wild-typeLaboratory-evolved resistance may differ from clinical resistance

By systematically addressing these considerations, researchers can establish whether nuoA and NADH-quinone oxidoreductase function contribute directly to the unique aminoglycoside susceptibility of B. vietnamiensis, potentially revealing novel targets for combination therapies against this opportunistic pathogen.

How can I assess the impact of environmental conditions on nuoA expression and function in B. vietnamiensis during plant-microbe interactions?

Assessing the impact of environmental conditions on nuoA expression and function in B. vietnamiensis during plant-microbe interactions requires integration of molecular, biochemical, and ecological approaches:

Experimental system establishment:

  • Plant-microbe interaction models:

    • Gnotobiotic systems with different rice varieties (japonica and indica)

    • Rhizobox systems allowing access to different root zones

    • Split-root systems to examine local vs. systemic responses

    • Hydroponic systems for controlled nutrient manipulation

  • Environmental parameter control:

    • Oxygen gradients: Use microelectrodes to measure and manipulate oxygen concentration

    • pH variations: Buffer systems to maintain different rhizosphere pH values

    • Carbon source availability: Supplement with different plant exudates

    • Nitrogen status: Vary N availability to modulate nitrogen fixation requirements

Gene expression analysis:

  • Reporter systems:

    • Construct transcriptional fusions of nuoA promoter with fluorescent proteins (GFP, mCherry)

    • Develop luciferase-based reporters for real-time monitoring

    • Use FACS to analyze single-cell expression levels in bacterial populations recovered from plant roots

  • Quantitative expression methods:

    • RT-qPCR for nuoA and related genes under various conditions

    • RNA-Seq to place nuoA regulation in context of global transcriptional responses

    • Proteomics to confirm translation of nuoA mRNA into protein

  • In situ visualization:

    • Fluorescence in situ hybridization (FISH) targeting nuoA mRNA

    • Immunofluorescence microscopy using antibodies against nuoA protein

    • Correlative light and electron microscopy to relate expression to cellular ultrastructure

Functional analysis:

  • Energy metabolism measurements:

    • NAD+/NADH ratios in bacteria recovered from different root zones

    • ATP levels as indicators of energetic status

    • Membrane potential measurements using voltage-sensitive dyes

  • Respiration and nitrogen fixation coupling:

    • Acetylene reduction assays to measure nitrogenase activity

    • Oxygen consumption rates in relation to nitrogen fixation

    • Carbon source utilization patterns during plant colonization

  • Competitive fitness assays:

    • Co-inoculate wild-type and nuoA mutants at different ratios

    • Track population dynamics during colonization

    • Use Tn-seq approaches to identify genes that interact with nuoA during colonization

Environmental correlation:

  • Microenvironmental sampling:

    • Use micromanipulators to sample bacteria from specific root microsites

    • Measure local oxygen, pH, and exudate concentrations

    • Correlate these parameters with nuoA expression levels

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Develop models of nuoA regulation in response to environmental variables

    • Identify key environmental triggers for expression changes

Table 3: Experimental Design for Assessing Environmental Impacts on nuoA During Plant Colonization

Environmental VariableMeasurement MethodExpression AnalysisFunctional Readout
Oxygen concentrationMicroelectrodes, oxygen-sensitive dyesRT-qPCR, reporter constructsRespiration rate, ATP production
Carbon sourceRoot exudate analysis, 13C labelingRNA-Seq comparing different C sourcesGrowth rate, competitive index
pHMicroelectrodes, pH-sensitive dyesPromoter activity at different pHMembrane potential, protein stability
Plant genotypeDifferent rice varietiesTranscriptome comparison between hostsColonization efficiency, spatial distribution
Nitrogen availability15N-labeling, nitrogen fixation assaysnuoA expression during N2 fixation vs. N-replete conditionsEnergetic cost of N2 fixation, nitrogen fixation rates

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.