Recombinant Burkholderia vietnamiensis NADH-quinone oxidoreductase subunit A (nuoA) is a bacterial membrane protein expressed in engineered systems, typically E. coli, for research and biotechnological applications. It is a component of the NADH dehydrogenase I (NDH-1) complex, which facilitates electron transfer from NADH to quinones during aerobic respiration, coupling this process to proton translocation across the inner membrane . The recombinant form retains structural and functional features of the native protein, making it a critical tool for studying bacterial respiratory pathways, enzyme kinetics, and pathogenicity mechanisms in Burkholderia species.
| Property | Value/Description |
|---|---|
| Uniprot ID | A4JGD0 |
| Gene Name | nuoA |
| Protein Length | 119 amino acids (full-length) |
| Expression Host | E. coli |
| Tag | N-terminal His-tag |
| Molecular Weight | 13.4 kDa (predicted) |
| Subcellular Location | Inner membrane |
The protein contains a His-tag for purification and is lyophilized in a Tris/PBS-based buffer with trehalose stabilizers . Its sequence begins with MNLAAYYPVLLFLLVGTGLGIALVSIGKLLGPNKPDVEKNAPYECGFEAFEDARMKFDVR..., with conserved motifs critical for quinone binding and proton translocation .
Recombinant nuoA is expressed in E. coli and purified via affinity chromatography. Suppliers report >90% purity by SDS-PAGE, with a typical yield of 50 µg per vial . Key steps include:
KEGG: bvi:Bcep1808_2334
STRING: 269482.Bcep1808_2334
Burkholderia vietnamiensis is a bacterial species belonging to the Burkholderia cepacia complex (BCC). It occupies a unique ecological niche as it can function both as a plant growth-promoting bacterium and as an opportunistic human pathogen. B. vietnamiensis is primarily recognized as the first validated nitrogen-fixing species within the Burkholderia genus . The bacterium was initially isolated from the rhizosphere of rice plants grown in Vietnamese soil and has since been found to colonize various plant hosts including rice (Oryza sativa subspecies japonica and indica), maize, and coffee plants in geographically diverse regions .
The ecological significance of B. vietnamiensis lies in its ability to:
Fix atmospheric nitrogen in association with plant roots
Promote plant growth through various mechanisms
Adapt to different plant hosts with specific genetic strategies
While beneficial in agricultural contexts, B. vietnamiensis can also act as an opportunistic pathogen in immunocompromised individuals, particularly patients with cystic fibrosis .
NADH-quinone oxidoreductase (NUO) is a membrane-associated enzyme complex that catalyzes the oxidation of NADH to NAD+, transferring electrons to quinones in the respiratory chain. In Burkholderia species, this enzyme plays a crucial role in energy metabolism.
The specific role of subunit A (nuoA) in Burkholderia vietnamiensis involves:
Contributing to the structural integrity of the membrane-embedded portion of the enzyme complex
Participating in the formation of proton translocation channels
Supporting the coupling mechanism that links electron transfer to ion transport across the membrane
Unlike the NADH-quinone oxidoreductase from Vibrio cholerae (Na+-NQR), which functions as a sodium pump , the B. vietnamiensis NUO complex is thought to primarily transport protons, although complete characterization of its ion specificity requires further research.
Effective expression and purification of recombinant B. vietnamiensis NADH-quinone oxidoreductase subunit A (nuoA) requires careful optimization of several parameters. Based on established protocols for similar membrane proteins, the following methodology is recommended:
Expression system optimization:
Select an appropriate expression vector containing a promoter system that allows tight regulation (such as the P(BAD) promoter used for the nqr operon in V. cholerae)
Design the construct with a His-tag, preferably at the N-terminus of the protein
Express in E. coli expression systems optimized for membrane proteins (e.g., C41(DE3) or C43(DE3) strains)
Expression conditions:
Culture temperature: 30°C for initial growth, reduced to 16-18°C post-induction
Induction parameters: 0.5-1.0 mM IPTG (or appropriate inducer)
Duration: 4-6 hours post-induction at reduced temperature
Purification protocol:
Cell disruption via sonication or French press in buffer containing protease inhibitors
Membrane fraction isolation through differential centrifugation
Membrane protein solubilization using appropriate detergents (dodecyl maltoside has been successfully used for related NADH-quinone oxidoreductases)
Affinity chromatography using Ni-NTA resin
Size exclusion chromatography for further purification
The choice of detergent is critical as it affects enzyme activity and cofactor retention. For instance, with the related Na+-NQR from V. cholerae, dodecyl maltoside (DM) preserved ubiquinone binding, while LDAO resulted in negligible quinone content .
Several established methodologies exist for detecting and characterizing B. vietnamiensis and its associated proteins in environmental or clinical samples:
Molecular detection methods:
16S rRNA gene amplification: PCR-based amplification of the 16S rRNA gene followed by sequence analysis can identify B. vietnamiensis, though this may be insufficient to discriminate between closely related BCC species
Recombinase-aided amplification (RAA) assay: A rapid method targeting the 16S rRNA gene, demonstrating 100% sensitivity and 98.5% specificity for BCC detection with results available in 10 minutes
recA gene analysis: RFLP analysis of PCR-amplified recA demonstrates sufficient nucleotide sequence variation to enable separation of all five B. cepacia complex genomovars, including B. vietnamiensis
Multilocus sequence typing (MLST): Analysis of multiple housekeeping genes provides higher resolution for species identification:
Protein characterization methods:
SDS-PAGE: For resolving subunits of multi-component enzymes like NADH-quinone oxidoreductase
Western blotting: Using specific antibodies against nuoA or other subunits
Activity assays: Measuring NADH oxidation rates spectrophotometrically
Mass spectrometry: For protein identification and post-translational modification analysis
| Method | Time Required | Sensitivity | Specificity | Advantages | Limitations |
|---|---|---|---|---|---|
| 16S rRNA PCR | 2-3 hours | Moderate | Moderate | Widely used standard | Insufficient discrimination between closely related BCC species |
| RAA assay | 10 minutes | High (10 copies/reaction) | 98.5% | Rapid results, high sensitivity | Requires specific equipment |
| recA gene analysis | 4-5 hours | High | High | Differentiates all BCC species | More complex procedure |
| MLST | 1-2 days | High | High | Highest resolution for strain typing | Labor intensive, expensive |
For specific identification of nuoA protein, mass spectrometry-based proteomics approaches following immunoprecipitation or affinity purification provide the most specific detection in complex biological samples.
The relationship between NADH-quinone oxidoreductase function and B. vietnamiensis pathogenicity or plant colonization capabilities represents a complex interplay of bioenergetics, metabolism, and host interaction:
Energy metabolism and colonization:
NADH-quinone oxidoreductase plays a critical role in bacterial energy metabolism, generating the proton motive force necessary for ATP synthesis. During plant root colonization, B. vietnamiensis faces varying oxygen levels and nutrient availability, requiring metabolic flexibility. Transposon sequencing (Tn-seq) studies have identified numerous genes involved in rice root colonization by B. vietnamiensis, with approximately 1,404 genes showing significant impact on fitness during colonization . While specific roles of NADH-quinone oxidoreductase subunits were not directly addressed in these studies, the importance of energy metabolism during colonization is evident.
Role in pathogenicity:
As an opportunistic pathogen in cystic fibrosis patients, B. vietnamiensis must adapt to the host environment. Several factors may link NADH-quinone oxidoreductase to pathogenicity:
Adaptation to low oxygen conditions: In the CF lung, bacteria often encounter microaerobic conditions, potentially requiring altered respiratory chain function.
Antimicrobial resistance: B. vietnamiensis shows intrinsic susceptibility to aminoglycosides (unlike other BCC species) but can develop resistance during chronic infection . Energy-dependent efflux pumps contribute to antimicrobial resistance, and their function depends on the proton motive force generated partly by respiratory complexes like NADH-quinone oxidoreductase.
Virulence factor expression: The expression of virulence factors, including the non-ribosomal peptide synthetase (NRPS) system that produces hemolytic compounds in B. vietnamiensis , may be regulated in response to energy status, implicating respiratory complexes in virulence control circuits.
Host-specific genetic strategies:
Comparative genomic studies have shown that B. vietnamiensis employs distinct genetic strategies when colonizing different rice varieties (japonica vs. indica) , suggesting host-specific adaptation mechanisms. These differential strategies likely involve metabolic adjustments where NADH-quinone oxidoreductase function may be implicated, although direct evidence for its role in host-specific adaptation requires further investigation.
Designing experiments to investigate the role of nuoA in B. vietnamiensis bioenergetics and host interaction requires a multifaceted approach:
Genetic manipulation strategies:
Gene deletion/disruption: Generate nuoA knockout mutants using suicide vectors similar to approaches used for other Burkholderia genes . Consider:
Complementation studies: Restore the wild-type phenotype by expressing nuoA in trans from a plasmid to confirm phenotypic changes are directly attributable to nuoA loss.
Site-directed mutagenesis: Introduce specific amino acid changes to investigate structure-function relationships in nuoA.
Functional characterization experiments:
Growth phenotyping: Compare growth rates of wild-type and nuoA mutants under various conditions:
Different carbon sources
Oxygen availability (aerobic, microaerobic, anaerobic)
Various stress conditions (pH, temperature, osmotic stress)
Membrane potential measurement: Use fluorescent dyes (e.g., DiSC3(5)) to assess changes in membrane potential in nuoA mutants.
Respiratory chain function: Measure NADH oxidation rates and oxygen consumption in membrane vesicles from wild-type and mutant strains.
ATP synthesis: Determine ATP levels and synthesis rates to assess bioenergetic consequences of nuoA disruption.
Host interaction studies:
Plant colonization assays:
Inoculate rice plants (both japonica and indica varieties) with wild-type and nuoA mutants
Quantify colonization by plating serial dilutions of homogenized plant tissues
Use fluorescently tagged strains for microscopic visualization of colonization patterns
Transposon sequencing (Tn-seq): Compare the contribution of different genes to fitness during root colonization in wild-type versus nuoA mutant backgrounds to identify genetic interactions .
Infection models:
Protein-protein interaction studies:
Co-immunoprecipitation: Identify interaction partners of nuoA within the NADH-quinone oxidoreductase complex and potentially with other cellular components.
Bacterial two-hybrid assays: Systematically map interactions between nuoA and other subunits.
Cross-linking studies: Use chemical cross-linking followed by mass spectrometry to identify spatial relationships within the complex.
Analyzing the contribution of nuoA to aminoglycoside susceptibility in B. vietnamiensis requires careful consideration of several factors, as B. vietnamiensis displays unique antibiotic susceptibility profiles compared to other BCC species:
Experimental design considerations:
Strain selection and validation:
Susceptibility testing methodologies:
Perform standardized broth microdilution assays following CLSI guidelines
Determine MICs for multiple aminoglycosides (tobramycin, gentamicin, amikacin)
Include time-kill kinetics to assess the rate of bacterial killing
Evaluate susceptibility under various growth conditions that may affect respiratory chain function
Membrane potential and aminoglycoside uptake:
Assess membrane potential using fluorescent probes (DiSC3(5))
Measure aminoglycoside uptake using radiolabeled antibiotics or fluorescently labeled derivatives
Use protonophores like CCCP as controls for membrane potential disruption
Employ NPN uptake assays to measure outer membrane permeability changes
Genetic manipulation approaches:
nuoA gene knockout and complementation:
Generate nuoA deletion mutants in aminoglycoside-susceptible B. vietnamiensis strains
Complement with wild-type nuoA expressed from a plasmid
Create site-directed mutants in conserved residues of nuoA
Gene expression analysis:
Monitor expression of nuoA and other respiratory complex genes under antibiotic pressure
Compare expression profiles between susceptible and resistant isolates
Analyze global transcriptomic changes in nuoA mutants to identify compensatory mechanisms
Mechanistic investigations:
Respiratory chain function analysis:
Measure NADH-quinone oxidoreductase activity in membrane preparations
Assess respiratory rates in intact cells and membrane vesicles
Determine if aminoglycoside treatment affects electron transport chain function
Adaptive resistance development:
| Approach | Key Parameters | Expected Outcomes | Limitations |
|---|---|---|---|
| MIC determination | Concentration range, medium composition, incubation time | Quantitative measure of susceptibility changes in nuoA mutants | May not reveal mechanism of action |
| Membrane potential measurement | Probe selection, cell density, calibration | Direct assessment of nuoA's role in maintaining membrane potential | Potential artifacts from fluorescent probes |
| Aminoglycoside uptake | Antibiotic concentration, time points, separation method | Correlation between nuoA function and drug accumulation | Technical challenges with quantification |
| Gene expression analysis | Growth conditions, RNA extraction method, normalization | Regulatory networks affected by nuoA disruption | Expression changes may be indirect |
| Adaptive resistance | Selection pressure, passage number, stability testing | Rate of resistance development in nuoA mutants vs. wild-type | Laboratory-evolved resistance may differ from clinical resistance |
By systematically addressing these considerations, researchers can establish whether nuoA and NADH-quinone oxidoreductase function contribute directly to the unique aminoglycoside susceptibility of B. vietnamiensis, potentially revealing novel targets for combination therapies against this opportunistic pathogen.
Assessing the impact of environmental conditions on nuoA expression and function in B. vietnamiensis during plant-microbe interactions requires integration of molecular, biochemical, and ecological approaches:
Experimental system establishment:
Plant-microbe interaction models:
Environmental parameter control:
Oxygen gradients: Use microelectrodes to measure and manipulate oxygen concentration
pH variations: Buffer systems to maintain different rhizosphere pH values
Carbon source availability: Supplement with different plant exudates
Nitrogen status: Vary N availability to modulate nitrogen fixation requirements
Gene expression analysis:
Reporter systems:
Construct transcriptional fusions of nuoA promoter with fluorescent proteins (GFP, mCherry)
Develop luciferase-based reporters for real-time monitoring
Use FACS to analyze single-cell expression levels in bacterial populations recovered from plant roots
Quantitative expression methods:
RT-qPCR for nuoA and related genes under various conditions
RNA-Seq to place nuoA regulation in context of global transcriptional responses
Proteomics to confirm translation of nuoA mRNA into protein
In situ visualization:
Fluorescence in situ hybridization (FISH) targeting nuoA mRNA
Immunofluorescence microscopy using antibodies against nuoA protein
Correlative light and electron microscopy to relate expression to cellular ultrastructure
Functional analysis:
Energy metabolism measurements:
NAD+/NADH ratios in bacteria recovered from different root zones
ATP levels as indicators of energetic status
Membrane potential measurements using voltage-sensitive dyes
Respiration and nitrogen fixation coupling:
Acetylene reduction assays to measure nitrogenase activity
Oxygen consumption rates in relation to nitrogen fixation
Carbon source utilization patterns during plant colonization
Competitive fitness assays:
Environmental correlation:
Microenvironmental sampling:
Use micromanipulators to sample bacteria from specific root microsites
Measure local oxygen, pH, and exudate concentrations
Correlate these parameters with nuoA expression levels
Multi-omics integration:
Combine transcriptomics, proteomics, and metabolomics data
Develop models of nuoA regulation in response to environmental variables
Identify key environmental triggers for expression changes
| Environmental Variable | Measurement Method | Expression Analysis | Functional Readout |
|---|---|---|---|
| Oxygen concentration | Microelectrodes, oxygen-sensitive dyes | RT-qPCR, reporter constructs | Respiration rate, ATP production |
| Carbon source | Root exudate analysis, 13C labeling | RNA-Seq comparing different C sources | Growth rate, competitive index |
| pH | Microelectrodes, pH-sensitive dyes | Promoter activity at different pH | Membrane potential, protein stability |
| Plant genotype | Different rice varieties | Transcriptome comparison between hosts | Colonization efficiency, spatial distribution |
| Nitrogen availability | 15N-labeling, nitrogen fixation assays | nuoA expression during N2 fixation vs. N-replete conditions | Energetic cost of N2 fixation, nitrogen fixation rates |