Recombinant Burkholderia vietnamiensis NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently available in stock. If you have a specific format requirement, kindly indicate it in your order notes and we will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of the product is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; Bcep1808_2324; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Burkholderia vietnamiensis (strain G4 / LMG 22486) (Burkholderia cepacia (strain R1808))
Target Names
nuoK
Target Protein Sequence
MLTLAHYLVLGAILFAMSIVGIFLNRRNIIIILMAIELMLLAVNTNFVAFSHYLGDVHGQ IFVFFVLTVAAAEAAIGLAILVTLFRKLDTINVEDLDQLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this particular species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. The enzyme couples the redox reaction with proton translocation, transporting four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Burkholderia vietnamiensis and how does it differ from other Burkholderia cepacia complex species?

Burkholderia vietnamiensis is a gram-negative bacterium belonging to the Burkholderia cepacia complex (BCC), a group of opportunistic pathogens that can cause severe infections in immunocompromised individuals, particularly cystic fibrosis patients. Unlike other BCC species, B. vietnamiensis demonstrates unusual susceptibility to aminoglycosides while maintaining resistance to other cationic antimicrobial agents . This distinct susceptibility profile makes it a valuable model for studying differential antimicrobial resistance mechanisms within the BCC. B. vietnamiensis has been identified in clinical settings in various countries including Mexico, where it was recently documented alongside B. multivorans, B. contaminans, and B. cepacia .

What is NADH-quinone oxidoreductase subunit K (nuoK) and what is its functional significance?

NADH-quinone oxidoreductase subunit K (nuoK) is a membrane protein component of respiratory complex I (NADH dehydrogenase I), which plays a crucial role in bacterial energy metabolism. The protein is encoded by the nuoK gene (e.g., BceJ2315_22940 in B. cepacia) . As part of the membrane domain of complex I, nuoK contributes to proton translocation across the bacterial membrane, coupling electron transfer from NADH to quinone with proton pumping. This process is fundamental to cellular respiration and ATP generation. The protein consists of 101 amino acids with a highly hydrophobic profile, containing multiple transmembrane domains that anchor it within the bacterial membrane .

How can researchers accurately identify Burkholderia vietnamiensis in clinical or environmental samples?

Accurate identification of B. vietnamiensis requires a multi-faceted approach beyond conventional microbiological techniques. While automated systems like VITEK2 are commonly used in clinical settings, they frequently misidentify Burkholderia species, sometimes confusing them with Pseudomonas, Stenotrophomonas, or Providencia genera . For definitive identification, researchers should implement:

  • Molecular techniques: Multilocus sequence analysis (MLSA) targeting multiple housekeeping genes

  • Genomic fingerprinting: BOX-PCR to generate species-specific patterns

  • Whole genome analysis: For conclusive identification and phylogenetic placement

  • Phenotypic confirmation: Aminoglycoside susceptibility testing, as B. vietnamiensis typically shows greater susceptibility than other BCC members

A combination of these approaches provides the most reliable identification, particularly in complex clinical samples where multiple species may be present.

What experimental design is most appropriate for studying antimicrobial resistance development in B. vietnamiensis?

When investigating antimicrobial resistance development in B. vietnamiensis, a longitudinal experimental design with multiple control groups is recommended. The Solomon 4-Group Design offers particular advantages for this research . This design employs four groups: two experimental and two control, with pretesting in only one experimental and one control group. This approach allows researchers to:

  • Track resistance development over time

  • Control for the potential effects of repeated testing

  • Account for external variables

GroupPretestTreatmentPosttest
1 (R)O₁X (Antibiotic Exposure)O₂
2 (R)O₃— (No Exposure)O₄
3 (R)X (Antibiotic Exposure)O₅
4 (R)— (No Exposure)O₆

R = Random assignment, O = Observation, X = Treatment

This design is particularly valuable when studying aminoglycoside resistance in B. vietnamiensis, as it allows researchers to distinguish between intrinsic and acquired resistance mechanisms, while controlling for the potential effects of repeated testing on bacterial populations . For example, this approach would effectively capture the phenomenon observed in clinical isolates where B. vietnamiensis strains acquired aminoglycoside resistance during chronic cystic fibrosis infection .

What methodology should be used to express and purify recombinant nuoK protein from B. vietnamiensis?

Expression and purification of recombinant nuoK from B. vietnamiensis presents challenges due to its hydrophobic nature and multiple transmembrane domains. A recommended methodology includes:

  • Vector selection: pET expression system with a fusion tag (His₆ or MBP) to aid solubility and purification

  • Host selection: E. coli C41(DE3) or C43(DE3) strains, which are engineered for membrane protein expression

  • Expression conditions:

    • Induction with low IPTG concentration (0.1-0.5 mM)

    • Reduced temperature (16-20°C)

    • Extended expression time (16-24 hours)

  • Membrane extraction: Detergent solubilization using mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG)

  • Purification:

    • Immobilized metal affinity chromatography (IMAC)

    • Size exclusion chromatography

    • Lipid reconstitution if functional studies are planned

The quality of purified protein should be assessed through SDS-PAGE, Western blotting, and circular dichroism to confirm structural integrity before proceeding to functional or structural studies .

How can researchers design experiments to investigate the role of nuoK in antimicrobial resistance?

To investigate nuoK's role in antimicrobial resistance, researchers should design experiments that combine genetic manipulation with phenotypic characterization:

  • Gene knockout/knockdown approaches:

    • CRISPR-Cas9 system for gene deletion

    • Antisense RNA for transient knockdown

    • Complementation studies to confirm phenotypes

  • Overexpression studies:

    • Controlled expression using inducible promoters

    • Analysis of resistance profiles with varying expression levels

  • Site-directed mutagenesis:

    • Target conserved residues in transmembrane domains

    • Focus on residues potentially involved in proton translocation

  • Phenotypic assays:

    • Minimum inhibitory concentration (MIC) determination

    • Time-kill kinetics

    • Membrane potential measurements

    • ATP synthesis quantification

  • Control considerations:

    • Include wild-type strains

    • Use empty vector controls for expression studies

    • Test multiple antibiotics from different classes

This experimental framework allows researchers to establish causality between nuoK function and antimicrobial resistance while controlling for confounding variables .

How should researchers analyze contradictory data regarding nuoK expression and aminoglycoside susceptibility?

When confronted with contradictory data regarding nuoK expression and aminoglycoside susceptibility, researchers should implement a systematic analytical approach:

  • Data validation:

    • Confirm experimental reproducibility through biological and technical replicates

    • Verify strain identities using molecular methods

    • Ensure antibiotic stability and activity throughout experiments

  • Statistical analysis:

    • Apply appropriate statistical tests (ANOVA, t-tests) with corrections for multiple comparisons

    • Calculate effect sizes to quantify the magnitude of differences

    • Implement more robust non-parametric tests if data violate normality assumptions

  • Contextual interpretation:

    • Consider strain-specific genetic backgrounds

    • Evaluate potential compensatory mechanisms

    • Assess growth conditions and their impact on gene expression

  • Integration with existing literature:

    • Compare results with findings on related Burkholderia species

    • Consider mechanisms reported in other bacteria with similar resistance patterns

  • Hypothesis refinement:

    • Develop alternative hypotheses that could explain contradictory results

    • Design targeted experiments to test these alternatives

This approach acknowledges that contradictions often reflect biological complexity rather than experimental error. B. vietnamiensis demonstrates unusual aminoglycoside susceptibility compared to other BCC members while maintaining resistance to other cationic agents—a seeming contradiction that likely reflects specific adaptations in membrane permeability and efflux systems .

What analytical techniques are most appropriate for studying nuoK protein-membrane interactions?

Studying nuoK protein-membrane interactions requires specialized analytical techniques that can probe membrane protein structure and function:

These methods collectively provide a comprehensive understanding of how nuoK integrates into membranes and contributes to complex I function, which may inform its role in antimicrobial resistance phenotypes .

How does nuoK from B. vietnamiensis compare structurally and functionally to homologs in other Burkholderia species?

Comparing nuoK from B. vietnamiensis with homologs in other Burkholderia species reveals important structural and functional insights:

SpeciesAmino Acid Identity (%)Key Structural DifferencesFunctional Implications
B. cenocepacia92.1Conservative substitutions in TM2Potentially altered proton pathway
B. multivorans89.3Variation in cytoplasmic loopModified interaction with matrix subunits
B. cepacia95.6Nearly identical structureSimilar functional properties
B. pseudomallei80.2Significant divergence in C-terminusAdapted to intracellular lifestyle

Functionally, these variations may influence:

These differences correlate with the distinctive antimicrobial susceptibility profiles observed across Burkholderia species, particularly the unusual aminoglycoside susceptibility of B. vietnamiensis compared to other BCC members .

What are the considerations for designing in vivo experiments to study nuoK function in infection models?

When designing in vivo experiments to study nuoK function in infection models, researchers must address several advanced considerations:

  • Model selection:

    • Chronic vs. acute infection models

    • Animal models that recapitulate cystic fibrosis lung environment

    • Cell culture systems for specific aspects of host-pathogen interaction

  • Strain engineering:

    • Conditional expression systems to regulate nuoK in vivo

    • Reporter strains to monitor nuoK expression during infection

    • Complementation strategies that minimize fitness costs

  • Experimental controls:

    • Isogenic strains differing only in nuoK

    • Monitoring for compensatory mutations

    • Assessment of in vitro vs. in vivo growth dynamics

  • Outcome measurements:

    • Bacterial burden in different tissues

    • Inflammatory responses

    • Development of resistance during infection

    • Competitive index with wild-type strains

  • Ethical and biosafety considerations:

    • Appropriate containment for work with opportunistic pathogens

    • Reduction of animal use through pilot studies and power calculations

    • Consideration of alternative models where appropriate

These considerations ensure that in vivo experiments generate meaningful data about nuoK function in the complex environment of host infection, particularly in understanding how B. vietnamiensis may develop aminoglycoside resistance during chronic infection of cystic fibrosis patients .

What are common pitfalls in recombinant nuoK expression and how can they be addressed?

Recombinant expression of nuoK presents several challenges due to its hydrophobic nature and integral membrane position. Common pitfalls and their solutions include:

  • Low expression levels:

    • Pitfall: Standard expression conditions yield minimal protein

    • Solution: Optimize codon usage for expression host, use specialized strains (C41/C43), lower induction temperature (16-20°C), and extend expression time (16-24 hours)

  • Protein aggregation:

    • Pitfall: nuoK forms inclusion bodies

    • Solution: Express with solubility-enhancing fusion partners (MBP, SUMO), add mild detergents during lysis, optimize buffer conditions

  • Poor membrane integration:

    • Pitfall: Expressed protein fails to integrate properly into membranes

    • Solution: Use specialized membrane protein expression systems, optimize signal sequences, consider cell-free expression in the presence of lipid nanodiscs

  • Functional inactivity:

    • Pitfall: Purified protein lacks expected activity

    • Solution: Ensure native-like lipid environment during purification, maintain reducing conditions, verify proper folding with circular dichroism

  • Proteolytic degradation:

    • Pitfall: Rapid degradation during expression or purification

    • Solution: Add protease inhibitors, optimize purification speed, identify and mutate susceptible sites

Implementing these solutions increases the likelihood of successfully expressing functional recombinant nuoK for subsequent structural and functional studies .

How can researchers validate experimental results when studying complex antimicrobial resistance mechanisms in B. vietnamiensis?

Validating experimental results when studying complex antimicrobial resistance mechanisms in B. vietnamiensis requires a multi-faceted approach:

  • Biological validation:

    • Use multiple clinical and environmental isolates to confirm observations

    • Compare closely related strains with different resistance profiles

    • Implement longitudinal studies to track resistance development

  • Technical validation:

    • Employ multiple complementary methods to measure resistance

    • Conduct dose-response experiments rather than single concentrations

    • Use standardized antibiotic susceptibility testing methods (CLSI/EUCAST)

  • Genetic validation:

    • Perform gene knockout and complementation studies

    • Sequence entire operons and regulatory regions

    • Assess polar effects on adjacent genes

  • Functional validation:

    • Measure enzyme activity directly when possible

    • Assess membrane potential and permeability

    • Quantify antibiotic accumulation in bacterial cells

  • Controls and standards:

    • Include reference strains with well-characterized resistance profiles

    • Implement internal controls for normalization

    • Use biological and technical replicates with appropriate statistical analysis

What are the future research directions for understanding nuoK's role in B. vietnamiensis biology and pathogenesis?

Future research on nuoK in B. vietnamiensis should focus on several promising directions:

  • Structural biology: Determine high-resolution structures of nuoK within the complete respiratory complex I to understand species-specific features that may contribute to energy metabolism and antibiotic interactions.

  • Systems biology approaches: Integrate transcriptomics, proteomics, and metabolomics to understand how nuoK expression responds to environmental changes and antibiotic stress.

  • Host-pathogen interactions: Investigate how nuoK function influences bacterial persistence in host environments, particularly in chronic infections where B. vietnamiensis can acquire aminoglycoside resistance.

  • Comparative genomics: Expand analysis across more clinical and environmental isolates to identify natural variations in nuoK and correlate with phenotypic differences.

  • Therapeutic targeting: Explore whether nuoK represents a potential target for novel therapeutics that could exploit the unique energetic dependencies of B. vietnamiensis.

These research directions will contribute to a comprehensive understanding of nuoK's role in B. vietnamiensis biology and potentially inform new strategies for managing infections caused by this opportunistic pathogen .

How can cross-disciplinary approaches enhance our understanding of respiratory complexes in antimicrobial resistance?

Cross-disciplinary approaches provide unique insights into respiratory complexes and antimicrobial resistance by integrating diverse expertise:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.