Recombinant Burkholderia vietnamiensis Probable intracellular septation protein A (Bcep1808_1842)

Shipped with Ice Packs
In Stock

Description

Overview of Bcep1808_1842

The protein is encoded by the Bcep1808_1842 gene, annotated as a probable intracellular septation protein. Septation proteins are critical for bacterial cell division, particularly in coordinating membrane invagination and peptidoglycan remodeling during cytokinesis. Recombinant production enables study of its structural and functional roles in Burkholderia species .

Production and Purification

Produced in Escherichia coli expression systems, the protein is lyophilized to enhance stability. Critical protocols include:

  • Expression Host: E. coli BL21(DE3) or similar strains .

  • Purification: Immobilized metal affinity chromatography (IMAC) via His tag .

  • Storage: Long-term storage at -80°C; working aliquots stable at 4°C for ≤7 days .

Research Applications

This recombinant protein is primarily used for:

  • Antibody Development: As an immunogen for detecting B. vietnamiensis infections .

  • Structural Studies: Investigating membrane protein interactions via crystallography or NMR .

  • Pathogenicity Studies: Probing mechanisms of antibiotic resistance in Burkholderiaceae .

Key Challenges and Limitations

  • Stability: Repeated freeze-thaw cycles degrade activity .

  • Functional Redundancy: Potential overlap with other septation proteins complicates in vivo studies .

  • Pathogenicity Risks: Requires BSL-2 handling due to Burkholderia’s opportunistic nature .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; Bcep1808_1842; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Burkholderia vietnamiensis (strain G4 / LMG 22486) (Burkholderia cepacia (strain R1808))
Target Names
Bcep1808_1842
Target Protein Sequence
MKFLFDLFPIILFFAAFKVWGIFTATAVAIVATLAQVAWVAFRHRKVDTMLWVSLGVIVV FGGATLVLHDEKFIQWKPTVLYWLFAIGLLAARYAFGNNLIEKMMGKQLTLPHPVWDKLN VAWALFFAVLGLANLYVVHNFTESQWVNFKLFGTTGAMVVFIILQSLWLTKYLKDE
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Bcep1808_1842 and what is its significance in bacterial cell biology?

Bcep1808_1842 (UniProt ID: A4JEZ2) is classified as a probable intracellular septation protein A from Burkholderia vietnamiensis. It is also known as yciB or Inner membrane-spanning protein YciB . As a septation protein, it likely plays a critical role in bacterial cell division processes. The protein consists of 176 amino acids and appears to be membrane-associated based on its sequence properties .

The significance of this protein in bacterial cell biology relates to the fundamental process of cell division, which requires precise spatial and temporal regulation of septum formation. Intracellular septation proteins coordinate with other cell division machinery to ensure accurate chromosomal segregation and cytokinesis. Understanding Bcep1808_1842's function contributes to our knowledge of bacterial cell division mechanisms, which differ significantly from eukaryotic processes and may provide insights into potential antimicrobial targets.

How should researchers design experiments to express and purify recombinant Bcep1808_1842?

When designing experiments for expression and purification of recombinant Bcep1808_1842, researchers should consider the following methodological approach:

Expression System Selection:
E. coli has been successfully used for Bcep1808_1842 expression , but researchers should evaluate multiple expression systems if initial attempts yield poor results. For membrane proteins like Bcep1808_1842, specialized E. coli strains designed for membrane protein expression may be advantageous.

Vector and Tag Design:
Histidine tags have been successfully employed for Bcep1808_1842 , allowing for purification via immobilized metal affinity chromatography (IMAC). Consider the tag position (N- or C-terminal) based on predicted protein topology to ensure accessibility during purification.

Expression Conditions:

  • Test induction temperatures (16-37°C)

  • Vary inducer concentrations

  • Assess different media compositions

  • Determine optimal induction timing

Purification Strategy:
For membrane proteins like Bcep1808_1842, a typical workflow should include:

  • Cell lysis under conditions that preserve protein structure

  • Membrane fraction isolation through differential centrifugation

  • Solubilization using appropriate detergents (test multiple options)

  • IMAC purification with optimization of imidazole concentration gradient

  • Size exclusion chromatography for final polishing and buffer exchange

This methodological framework provides a starting point that can be optimized based on experimental results and specific research objectives.

How should researchers approach unexpected or contradictory data when studying Bcep1808_1842?

When confronted with data that contradicts initial hypotheses about Bcep1808_1842 function or properties, researchers should implement a systematic analytical approach:

Step 1: Thorough Data Examination
Begin by carefully analyzing all data to identify specific patterns of discrepancy. Compare your findings with existing literature on related septation proteins and look for outliers that may influence results . For Bcep1808_1842, this might involve comparing localization patterns, interaction profiles, or phenotypic effects to those documented for septation proteins in other bacterial species.

Step 2: Methodological Validation
Evaluate experimental protocols for potential technical artifacts:

  • Confirm protein identity through mass spectrometry

  • Assess protein quality via multiple biophysical techniques

  • Verify reagent specificity and experimental conditions

  • Review statistical approaches for data analysis

Step 3: Alternative Hypothesis Development
Generate new hypotheses that accommodate both expected and unexpected observations. For Bcep1808_1842, consider:

  • Potential moonlighting functions beyond septation

  • Condition-specific activity profiles

  • Indirect effects on division through unanticipated pathways

  • Species-specific functional adaptations in B. vietnamiensis

Step 4: Targeted Validation Experiments
Design focused experiments to test revised hypotheses:

  • Utilize complementary methodological approaches

  • Include additional controls

  • Modify experimental conditions to test context-dependency

  • Employ genetic approaches (knockouts, point mutations) to validate specific functional predictions

This systematic framework transforms contradictory data from a research obstacle into an opportunity for novel insights about Bcep1808_1842 function .

What approaches are recommended for analyzing Bcep1808_1842 interactions with other bacterial division proteins?

Analyzing protein-protein interactions for Bcep1808_1842 requires integrating multiple methodological approaches due to its membrane-associated nature. Researchers should implement a hierarchical experimental strategy:

Primary Interaction Screening:

  • Bacterial Two-Hybrid (B2H) Assays: Adapt traditional B2H systems for membrane protein analysis by using appropriate fusion constructs that preserve membrane topology.

  • Co-Immunoprecipitation with Crosslinking: Employ membrane-permeable crosslinkers before cell lysis to capture transient interactions.

  • Proximity-Based Labeling: Use BioID or APEX2 fusions to identify proteins in close proximity to Bcep1808_1842 in vivo.

Interaction Validation:

  • Microscopy-Based Colocalization: Utilize dual-color fluorescence microscopy to visualize potential colocalization with known division proteins during cell cycle progression.

  • FRET/BRET Analysis: For confirmed interaction candidates, employ these techniques to assess interaction dynamics in live cells.

  • Surface Plasmon Resonance: For purified components, determine binding kinetics and affinity constants.

Functional Relevance Assessment:

  • Genetic Interaction Mapping: Create genetic backgrounds with varying levels of potential interaction partners to identify synthetic phenotypes.

  • Domain Mapping: Generate truncation and point mutants to identify specific regions required for protein-protein interactions.

  • In Vitro Reconstitution: For key interactions, attempt to reconstitute minimal functional units in vitro.

Data analysis should incorporate control experiments including non-specific binding controls and careful normalization to account for expression level variations across experimental conditions.

How can researchers utilize recombinant Bcep1808_1842 in studies of bacterial cell division mechanisms?

Recombinant Bcep1808_1842 can serve as a powerful tool for dissecting bacterial cell division mechanisms through multiple experimental approaches:

In Vitro Reconstitution Studies:

  • Integrate purified Bcep1808_1842 into artificial membrane systems (liposomes, nanodiscs) to study its effects on membrane properties and curvature.

  • Combine with other division proteins to reconstitute partial or complete divisome assemblies in controlled environments.

  • Develop biochemical assays to measure potential enzymatic activities associated with septation.

Structural Biology Applications:

  • Use purified protein for crystallization trials or cryo-EM analysis, potentially revealing structural mechanisms of action.

  • Perform hydrogen-deuterium exchange mass spectrometry to map dynamic regions and conformational changes upon interaction with binding partners.

  • Implement solution NMR for dynamic studies of smaller domains or loops.

Comparative Systems Biology:

  • Express Bcep1808_1842 in heterologous bacterial systems to assess functional conservation across species.

  • Perform genome-wide interaction screens in different bacterial backgrounds to identify species-specific pathways.

  • Integrate with computational models of bacterial cell division to test predictions about septation protein function.

Live Cell Dynamics:

  • Create fluorescent protein fusions for real-time imaging of Bcep1808_1842 dynamics during cell division.

  • Implement super-resolution microscopy to precisely map localization relative to other divisome components.

  • Utilize microfluidic systems to monitor division under controlled environmental perturbations.

These methodological approaches leverage recombinant Bcep1808_1842 to address fundamental questions about bacterial septation mechanisms while potentially revealing species-specific adaptations in B. vietnamiensis.

What methodological approaches should be used to study potential roles of Bcep1808_1842 in cell partitioning asymmetries?

Investigating Bcep1808_1842's potential roles in cell partitioning asymmetries requires sophisticated experimental approaches that can detect and quantify subtle differences between daughter cells:

Single-Cell Tracking and Lineage Analysis:

  • Implement microfluidic systems that trap individual bacteria, allowing for long-term observation through multiple generations.

  • Apply automated image analysis algorithms to track cell lineages and measure morphological parameters, division times, and growth rates across generations .

  • Correlate Bcep1808_1842 localization patterns with observed asymmetries in daughter cell characteristics.

Molecular Distribution Quantification:

  • Utilize fluorescent protein fusions to monitor the spatial distribution of Bcep1808_1842 before, during, and after cell division.

  • Implement fluorescence recovery after photobleaching (FRAP) to assess protein dynamics and potential differential retention at cell poles.

  • Quantify co-segregation patterns with other cellular components (nucleoids, protein aggregates) that exhibit asymmetric partitioning .

Genetic Manipulation Strategies:

  • Create depletion strains to analyze the effects of reduced Bcep1808_1842 levels on partitioning symmetry.

  • Generate mutant variants to identify domains responsible for potential asymmetric localization.

  • Implement inducible expression systems to examine dose-dependent effects on cellular asymmetries.

Mathematical Modeling:

  • Develop stochastic models of molecule partitioning during division that incorporate experimental measurements of Bcep1808_1842 dynamics .

  • Simulate long-term consequences of different partitioning schemes on cellular fitness.

  • Compare model predictions with experimental measurements to refine hypotheses about Bcep1808_1842 function.

This integrated approach can reveal whether Bcep1808_1842 contributes to functional asymmetries in bacterial cell division, potentially connecting to broader concepts of bacterial aging and stress response mechanisms.

What strategies can researchers employ when facing challenges in expressing soluble recombinant Bcep1808_1842?

When encountering solubility challenges with recombinant Bcep1808_1842, researchers should implement a systematic troubleshooting approach:

Expression System Optimization:

  • Bacterial Strain Selection: Test specialized E. coli strains designed for membrane proteins (C41, C43, Lemo21).

  • Codon Optimization: Analyze the coding sequence for rare codons and consider synthesizing an optimized gene for the expression host.

  • Fusion Partners: Evaluate solubility-enhancing fusion partners such as MBP, SUMO, or Trx, positioned at either N- or C-terminus.

  • Expression Parameters: Systematically vary temperature (16-30°C), inducer concentration, and duration to identify conditions that favor proper folding.

Protein Engineering Approaches:

  • Domain Truncation: Based on bioinformatic analysis, design constructs capturing functional domains while excluding aggregation-prone regions.

  • Surface Mutagenesis: Identify and modify surface-exposed hydrophobic residues that might contribute to aggregation.

  • Cysteine Modification: Consider mutating non-essential cysteines that might cause inappropriate disulfide formation.

Extraction and Purification Optimization:

  • Detergent Screening: Test a panel of detergents (DDM, LDAO, OG, etc.) at various concentrations to identify optimal solubilization conditions.

  • Buffer Composition: Evaluate different pH values, salt concentrations, and additives (glycerol, arginine) to enhance stability.

  • Purification Strategy: Consider implementing on-column refolding protocols during affinity purification.

For Bcep1808_1842 specifically, researchers should note that the amino acid sequence (MKFLFDLFPIILFFAAFKVWGIFTATAVAIVATLAQVAWVAFRHRK...) indicates multiple hydrophobic regions , suggesting its native membrane association will require specialized approaches for obtaining soluble, properly folded protein.

How can researchers validate that purified recombinant Bcep1808_1842 maintains its native conformational properties?

Validating the native-like conformation of purified recombinant Bcep1808_1842 is critical for ensuring experimental results reflect physiologically relevant protein properties. Researchers should implement a multi-technique validation approach:

Biophysical Characterization:

  • Circular Dichroism (CD) Spectroscopy: Assess secondary structure content and compare with predictions based on the amino acid sequence. For membrane proteins like Bcep1808_1842, specialized CD protocols using detergent-solubilized samples should be employed.

  • Thermal Stability Analysis: Use differential scanning fluorimetry or CD thermal melts to determine stability profiles and potential stabilizing conditions.

  • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS): Confirm sample homogeneity and determine oligomeric state in solution.

Functional Validation:

  • Lipid Binding Assays: Assess interaction with relevant membrane lipids using techniques like liposome flotation assays or monolayer surface pressure measurements.

  • Protein-Protein Interaction Verification: Test binding to known or predicted interaction partners using pull-down assays or surface plasmon resonance.

  • Complementation Studies: Verify whether the purified protein can rescue phenotypes in deletion mutants when reintroduced.

Structural Integrity Assessment:

  • Limited Proteolysis: Compare digestion patterns of recombinant protein with those of native protein to identify similarly protected domains.

  • Intrinsic Fluorescence Spectroscopy: Monitor the environment of tryptophan residues as indicators of proper folding.

  • Hydrogen-Deuterium Exchange Mass Spectrometry: Map solvent-accessible regions to confirm expected structural organization.

For membrane proteins like Bcep1808_1842, researchers should give special attention to the detergent environment, as improper detergent selection can significantly alter conformational properties. Testing multiple detergents and validating results across different membrane-mimetic systems (nanodiscs, liposomes) provides additional confidence in structural integrity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.