Recombinant Burkholderia vietnamiensis Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Biological Function

HtpX is a membrane-bound zinc metalloprotease involved in:

  • Protein Quality Control: Degrades misfolded membrane proteins to prevent cytotoxicity .

  • Stress Response: Activated under stress conditions (e.g., heat shock) to maintain membrane protein homeostasis .

  • Virulence Potential: Burkholderia species, including B. vietnamiensis, utilize proteases like HtpX as virulence factors in opportunistic infections .

Production and Purification

Expression System:

  • Overexpressed in E. coli BL21(DE3) using pET-derived vectors .

Purification Protocol:

  1. Membrane Extraction: Detergent (octyl-β-D-glucoside) solubilization .

  2. Affinity Chromatography: Cobalt-based resin for His-tag binding .

  3. Anion-Exchange and Size-Exclusion Chromatography: Further refinement for homogeneity .

Yield: Milligram quantities obtained with >90% purity .

Research Applications

  • Enzymatic Assays: Used to study zinc-dependent proteolytic activity against casein and membrane proteins like SecY .

  • Structural Studies: Purified HtpX facilitates crystallography and mechanistic analyses of membrane proteases .

  • Pathogenicity Studies: Investigated in proteomic analyses of B. vietnamiensis virulence factors .

Key Research Findings

  • Self-Degradation: HtpX undergoes autoproteolysis upon membrane solubilization, necessitating zinc chelators during purification .

  • Substrate Specificity: Cleaves both soluble (e.g., casein) and membrane-embedded proteins (e.g., SecY) .

  • Taxonomic Utility: Differentiation of Burkholderia species via genomic probes, aiding clinical diagnostics .

Future Directions

  • Drug Development: Targeting HtpX’s active site to combat Burkholderia infections .

  • Mechanistic Studies: Elucidating its interaction with ATP-dependent proteases like FtsH .

  • Comparative Genomics: Expanding pan-genomic analyses to improve species-specific identification in cystic fibrosis patients .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
htpX; Bcep1808_3283; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
full length protein
Species
Burkholderia vietnamiensis (strain G4 / LMG 22486) (Burkholderia cepacia (strain R1808))
Target Names
htpX
Target Protein Sequence
MFNWVKTAMLMAAITALFIVIGGMIGGSRGMTIALLFALGMNFFSYWFSDKMVLRMYNAQ EVDEATAPQFYRMVRELATRANLPMPRVYLINEDAPNAFATGRNPEHAAVAATTGILRVL SEREMRGVMAHELAHVKHRDILISTITATMAGAISALANFAMFFGGRDENGRPANPIAGI AVALLAPIAGALIQMAISRAREFEADRGGAQISGDPQALATALDKIHRYAAGIPFQAAEA HPATAQMMIMNPLHGGGLQNLFSTHPATEERIARLMEMARTGRFD
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Burkholderia vietnamiensis Protease HtpX homolog and what is its genomic context?

Protease HtpX homolog is a membrane-bound zinc metalloprotease (EC 3.4.24.-) encoded by the htpX gene in Burkholderia vietnamiensis. It is found in the strain G4/LMG 22486 (formerly classified as Burkholderia cepacia strain R1808) with the ordered locus name Bcep1808_3283. This protein is identified in UniProt with accession number A4JJ20 and encompasses the expression region 1-285 . The full amino acid sequence reveals characteristics of a membrane-integrated protease with multiple transmembrane domains, which suggests its involvement in membrane protein quality control mechanisms. B. vietnamiensis possesses minimal growth requirements and demonstrates remarkable adaptability to various nutritional conditions, enabling survival in challenging environments .

How does HtpX protease relate to bacterial virulence and pathogenicity?

HtpX protease is considered among the potential virulence factors in Burkholderia species. Proteomics studies have identified numerous virulence factors associated with Burkholderia pathogenicity, including proteins involved in quorum-sensing that facilitate cell-to-cell communication and adherence . Unlike many virulence factors that are expressed at very low levels in bacterial cells, specialized proteomics approaches can now identify these factors without prior amplification . HtpX may contribute to bacterial stress response mechanisms that enhance survival within host environments. The relationship between membrane proteases like HtpX and virulence is increasingly recognized in opportunistic pathogens, as these enzymes often participate in stress adaptation, membrane integrity maintenance, and host-pathogen interactions essential for establishing infection.

What are the optimal conditions for expressing and purifying recombinant Burkholderia vietnamiensis Protease HtpX?

For optimal expression and purification of recombinant Burkholderia vietnamiensis Protease HtpX, researchers should consider the following methodological approach:

  • Expression System: Heterologous expression in E. coli systems is commonly used, but expression levels should be carefully monitored as membrane proteases can be toxic to host cells.

  • Growth Conditions: Cultivate B. vietnamiensis in minimal salt medium (MSM) supplemented with 2% glucose as the carbon source. Harvest cells in late exponential phase when optical density reaches approximately 1.6 at λ = 600 nm .

  • Protein Extraction: For membrane-bound proteins like HtpX, use fractionation approaches to separate the proteome into extracellular, cell surface, cell wall, and intracellular protein fractions .

  • Purification Strategy: Employ affinity chromatography using appropriate tags (determined during the production process) followed by size-exclusion chromatography to enhance purity .

  • Storage Conditions: Store the purified protein in Tris-based buffer with 50% glycerol at -20°C for general storage or -80°C for extended storage. Avoid repeated freezing and thawing. Working aliquots can be maintained at 4°C for up to one week .

This methodological approach optimizes both yield and bioactivity preservation of the recombinant protease.

How can researchers effectively detect and quantify HtpX protease activity in experimental systems?

Detection and quantification of HtpX protease activity requires specialized approaches due to its membrane association and potentially low expression levels:

  • Proteolytic Activity Assays: Utilize synthetic peptide substrates containing the preferential cleavage sites of HtpX, monitored through fluorescence or colorimetric detection upon cleavage.

  • Zymography Techniques: Employ substrate-impregnated gels that reveal proteolytic activity as clear zones after protein renaturation.

  • Mass Spectrometry-Based Approaches: Implement tandem mass spectrometry (LC-MS/MS) to analyze cleavage products and identify specific proteolytic signatures. This approach has proven particularly valuable for identifying low-abundance proteases in Burkholderia species .

  • Proteomics Analysis: Combine gel-based LC-MS/MS and gel-free multidimensional protein identification technology (MudPIT) to achieve comprehensive detection. The gel-based approach involves 1D SDS-PAGE separation followed by LC-MS/MS analysis, while MudPIT utilizes strong cation exchange followed by reverse phase separation before MS/MS analysis .

  • Data Validation: Apply multiple database search algorithms such as SEQUEST and X-Tandem, with subsequent validation using Scaffold software. Aim for at least 95% peptide identification probability and 99% protein identification probability, with the requirement of ≥2 peptides per protein .

This multifaceted approach enables reliable detection and quantification of HtpX protease activity across various experimental conditions.

What is the proposed mechanism of action for HtpX protease in bacterial membrane protein quality control?

HtpX protease functions as a key component in membrane protein quality control through a sophisticated mechanism:

  • Recognition of Misfolded Substrates: The transmembrane domains of HtpX enable it to scan the membrane for aberrantly folded or damaged proteins.

  • Proteolytic Processing: As a zinc metalloprotease (EC 3.4.24.-), HtpX cleaves specific peptide bonds within misfolded membrane proteins, utilizing a zinc ion in its active site to coordinate the hydrolysis reaction .

  • Integration with Stress Response Pathways: HtpX activity increases during cellular stress conditions, particularly those affecting membrane integrity. The protease likely works in concert with other quality control systems to maintain membrane homeostasis.

  • Complementary Role to FtsH Protease: Research in related bacterial systems suggests HtpX often functions as a complementary protease to FtsH, another membrane-bound protease. When FtsH is overwhelmed or compromised, HtpX provides an alternative degradation pathway for misfolded membrane proteins.

  • Signal Transduction Involvement: The protease may participate in signal transduction systems, potentially interacting with two-component regulatory systems that control cellular responses to environmental changes .

Understanding this mechanism provides insight into bacterial stress adaptation strategies and potential targets for antimicrobial development.

How does HtpX contribute to Burkholderia vietnamiensis adaptation to environmental stresses?

HtpX protease plays a crucial role in B. vietnamiensis adaptation to environmental stresses through several mechanisms:

  • Membrane Protein Homeostasis: By degrading damaged or misfolded membrane proteins, HtpX prevents their accumulation and potential toxicity during stress conditions.

  • Stress Response Regulation: HtpX likely participates in coordinated stress response pathways. Proteomics analyses have revealed that B. vietnamiensis possesses sophisticated adaptation mechanisms that allow it to thrive in diverse environmental conditions with minimal nutritional requirements .

  • Host Environment Adaptation: As an opportunistic pathogen, B. vietnamiensis must adapt to the host environment. HtpX may contribute to this adaptation by helping maintain membrane integrity during exposure to host defense mechanisms.

  • Virulence Factor Processing: Some evidence suggests membrane proteases like HtpX may process or activate certain virulence factors, contributing to pathogenicity through indirect mechanisms.

  • Biofilm Formation Support: Proteases can influence bacterial motility and biofilm formation. Research has shown that related histidine phosphotransferase (Hpt) mutants exhibit reduced swarming motility, suggesting a potential connection between membrane protein processing and mobility phenotypes .

This multifaceted contribution to stress adaptation makes HtpX an important factor in B. vietnamiensis environmental persistence and pathogenic potential.

What are the challenges in developing specific inhibitors against Burkholderia vietnamiensis HtpX protease?

Developing specific inhibitors against B. vietnamiensis HtpX protease presents several sophisticated challenges:

  • Membrane Localization: The membrane-embedded nature of HtpX (evident from its amino acid sequence: MFNWVKTAMLMAAITAIFIVIGGMIGGS...) creates accessibility barriers for potential inhibitors, requiring molecules with specific physicochemical properties to penetrate bacterial membranes .

  • Structural Complexity: The multiple transmembrane domains in HtpX create a complex three-dimensional architecture that complicates structure-based drug design approaches.

  • Functional Redundancy: Bacterial proteolytic systems often display functional redundancy, with multiple proteases capable of compensating for the loss of a single enzyme. Evidence from studies on histidine phosphotransferase systems suggests similar redundancy may exist in related regulatory pathways .

  • Specificity Requirements: Developing inhibitors with sufficient selectivity to target B. vietnamiensis HtpX without affecting human metalloproteases remains challenging. This requires detailed understanding of the structural differences between bacterial and human proteases.

  • Validation Systems: Establishing appropriate experimental systems to validate inhibitor efficacy requires specialized approaches. Current methodologies for proteomics analysis of B. vietnamiensis, including gel-based LC-MS/MS and MudPIT techniques, could be adapted for inhibitor screening and validation .

Addressing these challenges requires interdisciplinary approaches combining structural biology, medicinal chemistry, and advanced bacterial culture systems.

How can co-culture models be utilized to study HtpX function in host-pathogen interactions?

Co-culture models offer sophisticated systems for investigating HtpX function in host-pathogen interactions:

  • Human Bronchial Epithelial Cell Co-culture System: Researchers have developed co-culture biofilm models using human bronchial epithelial cells and bacterial pathogens to provide physiologically relevant environments for studying virulence mechanisms . This system can be adapted to investigate HtpX's role by comparing wild-type and htpX-deficient B. vietnamiensis strains.

  • Experimental Design Considerations:

    • Establish baseline parameters using minimal media conditions that favor virulence factor production

    • Monitor biofilm formation kinetics using confocal microscopy

    • Assess epithelial cell responses through cytotoxicity assays (e.g., LDH release)

    • Measure bacterial adherence and invasion efficiency

    • Compare proteome profiles using tandem mass spectrometry methods

  • Genetic Manipulation Approaches: Gene knockout methodologies, similar to those described for histidine phosphotransferase systems (∆hptA, ∆hptB, ∆hptC), can be employed to create htpX deletion mutants and complemented strains .

  • Signal Transduction Analysis: Co-culture models permit the investigation of how HtpX might participate in signal transduction pathways during host-pathogen interaction, potentially through mechanisms similar to those proposed for PA1396-PA1397 systems .

  • Alternative Models: The Galleria mellonella (wax moth) infection model provides a complementary in vivo system for validating findings from cell culture studies, offering a higher-throughput approach to assessing virulence .

These co-culture approaches enable researchers to investigate HtpX function under conditions that more accurately reflect the in vivo infection environment.

What strategies can overcome the challenges in expressing and purifying functional recombinant HtpX protease?

Membrane proteases like HtpX present significant purification challenges. The following methodological strategies can help overcome these obstacles:

  • Expression System Optimization:

    • Use tightly controlled inducible promoters to prevent toxicity

    • Consider specialized E. coli strains designed for membrane protein expression

    • Explore alternative expression hosts such as Pichia pastoris for complex membrane proteins

  • Solubilization and Extraction Protocol:

    • Implement a sequential extraction approach as described in proteomics studies of B. vietnamiensis

    • First separate the bacterial culture through centrifugation (5000 rpm for 20 min)

    • Process the bacterial supernatant to isolate extracellular proteins using trichloroacetic acid precipitation (10% w/v) at 4°C overnight

    • Fractionate the cell pellet to obtain intracellular, cell wall, and cell surface proteins

  • Detergent Selection and Optimization:

    • Test a panel of detergents including non-ionic (DDM, Triton X-100), zwitterionic (CHAPS), and mild ionic detergents

    • Optimize detergent concentration to maintain protein stability while achieving effective solubilization

    • Consider detergent exchange during purification steps

  • Storage and Stability Enhancement:

    • Store in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage

    • Avoid repeated freeze-thaw cycles

    • Maintain working aliquots at 4°C for maximum of one week

    • Test various stabilizing additives such as glycerol, specific metal ions, or reducing agents

  • Activity Verification Approach:

    • Develop activity assays compatible with detergent-solubilized preparations

    • Apply proteomics techniques like those described for B. vietnamiensis analysis, including LC-MS/MS and MudPIT approaches

These systematic approaches can significantly improve the yield and functionality of recombinant HtpX preparations.

How can researchers address data interpretation challenges when studying low-abundance proteins like HtpX?

Data interpretation for low-abundance proteins like HtpX presents unique challenges that can be addressed through sophisticated methodological approaches:

  • Advanced Mass Spectrometry Strategies:

    • Implement high-sensitivity LC-MS/MS techniques similar to those used in B. vietnamiensis proteomics studies

    • Utilize both gel-based and gel-free (MudPIT) approaches for complementary coverage

    • Apply data-dependent acquisition methods that prioritize low-intensity precursor ions

  • Robust Bioinformatics Pipeline:

    • Employ multiple search algorithms (e.g., SEQUEST and X-Tandem) to increase confidence in identifications

    • Validate results with specialized software like Scaffold, requiring ≥95% peptide identification probability and ≥99% protein identification probability

    • Apply stringent criteria requiring at least two unique peptides per protein

    • Calculate and report false discovery rates (aim for FDR <1%)

  • Quantification Considerations:

    • Implement stable isotope labeling approaches for relative quantification

    • Consider targeted proteomics (SRM/MRM) for focused analysis of HtpX and related proteins

    • Validate quantitative findings with orthogonal techniques when possible

  • Experimental Design Optimization:

    • Incorporate biological replicates (minimum of two) and technical replicates (three or more) for statistical robustness

    • Include appropriate controls for each step of the experimental workflow

    • Consider enrichment strategies targeting membrane proteins or metalloproteases

  • Data Integration Approach:

    • Correlate proteomics findings with functional assays and phenotypic observations

    • Consider systems biology approaches to place HtpX in the context of broader cellular pathways

    • Compare results across different growth conditions and cellular fractions

This comprehensive approach enhances confidence in data interpretation when studying challenging low-abundance membrane proteins like HtpX.

What are the emerging research opportunities for studying HtpX in antimicrobial resistance mechanisms?

The study of HtpX protease in antimicrobial resistance mechanisms presents several promising research directions:

  • Stress Response and Antibiotic Tolerance:

    • Investigate how HtpX-mediated membrane protein quality control contributes to bacterial survival during antibiotic exposure

    • Examine potential connections between HtpX activity and persistence phenotypes

    • Explore how minimal media conditions that enhance virulence factor production might affect antimicrobial susceptibility

  • Membrane Homeostasis and Drug Permeability:

    • Study how HtpX function affects membrane composition and integrity

    • Determine if HtpX activity modulates the uptake or efflux of antimicrobial compounds

    • Explore potential interactions between HtpX and known resistance determinants

  • Combination Therapy Approaches:

    • Test whether HtpX inhibitors could sensitize B. vietnamiensis to existing antibiotics

    • Develop screening platforms using co-culture models to identify synergistic drug combinations

    • Investigate whether targeting membrane protein quality control creates collateral sensitivity to specific antibiotic classes

  • Biofilm-Associated Resistance:

    • Examine HtpX's role in biofilm formation and maturation using co-culture models

    • Investigate connections between HtpX activity and biofilm-specific resistance mechanisms

    • Develop interventions targeting HtpX function in established biofilms

  • Host-Induced Stress Adaptation:

    • Study how host immune factors trigger HtpX-dependent responses

    • Determine if HtpX contributes to adaptation during host-pathogen interactions

    • Explore potential for host-directed therapies that might compromise HtpX function

These research directions offer significant potential for understanding and eventually targeting HtpX as part of novel antimicrobial strategies.

How might comparative analysis of HtpX across Burkholderia species advance our understanding of its evolutionary significance?

Comparative analysis of HtpX across Burkholderia species offers valuable insights into its evolutionary significance and functional adaptation:

  • Phylogenetic Analysis Framework:

    • Construct comprehensive phylogenetic trees based on HtpX sequences from diverse Burkholderia species

    • Compare evolutionary rates in pathogenic versus environmental isolates

    • Identify positively selected residues that might indicate adaptive evolution

    • Correlate sequence conservation patterns with known functional domains

  • Structure-Function Relationship Investigation:

    • Analyze amino acid sequence conservation across the transmembrane regions and catalytic domains

    • Identify species-specific variations that might reflect adaptation to different niches

    • Employ homology modeling to predict structural differences that influence substrate specificity

    • The complete amino acid sequence of B. vietnamiensis HtpX (MFNWVKTAMLMAAITAIFIVIGGMIGGS...) provides a foundation for such comparative studies

  • Genomic Context Analysis:

    • Examine the conservation of htpX genomic loci across Burkholderia species

    • Identify potential co-evolution with interacting partners

    • Investigate horizontal gene transfer events that might have shaped HtpX distribution

  • Functional Complementation Studies:

    • Develop genetic systems similar to those used for histidine phosphotransferase (Hpt) studies

    • Test cross-species complementation of htpX mutants to assess functional conservation

    • Determine if HtpX from different species exhibits distinct substrate preferences

  • Host Adaptation Correlation:

    • Compare HtpX sequences from species with different host preferences

    • Analyze whether sequence variations correlate with virulence potential

    • Integrate findings with proteomics data to understand expression patterns across species

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.