Recombinant Burkholderia xenovorans 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Mechanism

ubiA is a prenyltransferase that specifically prenylates 4-hydroxybenzoate (PHB) at its meta-position, generating intermediates for ubiquinone biosynthesis . The catalytic mechanism involves:

  1. Diphosphate cleavage: Release of the XPP (isoprenyl diphosphate) tail to form a carbocation intermediate.

  2. Regiospecific C–C bond formation: The carbocation reacts with PHB’s aromatic ring at the meta-position .

This activity is conserved in prokaryotes, where it supports membrane-bound electron transport and antioxidant defenses .

Biosynthetic Role in Burkholderia

In B. xenovorans LB400, a model PCB-degrading bacterium, ubiA is part of a genomic arsenal for aromatic compound metabolism. The strain’s large genome (9.73 Mbp) encodes 11 central and 20 peripheral pathways for aromatic degradation . While ubiA’s direct role in PCB catabolism is unconfirmed, its homologs in related species facilitate the biosynthesis of ubiquinones, which are essential for respiratory electron transport .

Recombinant Production and Functional Studies

Recombinant ubiA is produced for:

  • Enzymatic characterization: Studying substrate specificity (e.g., PHB derivatives) and metal ion dependencies (Mg²⁺ preferred) .

  • Biotechnological applications: Engineering pathways for prenylated compound production (e.g., antioxidants, antimicrobial agents) .

Genomic Context and Evolutionary Insights

B. xenovorans LB400’s genome reveals extensive horizontal gene transfer (>20% acquired via lateral transfer), contributing to its metabolic versatility . The ubiA gene (Bxe_A3983) is located on chromosome 1, alongside other aromatic degradation genes . This genomic organization suggests functional integration with peripheral pathways for biphenyl/benzoate metabolism .

Comparative Analysis with UbiA Superfamily Members

EnzymeSubstrateBiological RoleDisease Link
B. xenovorans ubiA4-HydroxybenzoateUbiquinone biosynthesis, membrane stabilityNone reported
E. coli UbiA4-HydroxybenzoateUbiquinone synthesisNone
Human COQ24-HydroxybenzoateUbiquinone-10 productionInfantile multisystem disease
Human UBIAD11,4-Dihydroxy-2-naphthoateMenaquinone synthesis, vascular homeostasisCardiovascular diseases, Parkinson’s

Experimental Tools and Resources

Recombinant ubiA is available as:

  • His-tagged proteins: For affinity chromatography and structural studies .

  • ELISA kits: For quantifying enzyme levels in research samples .

  • Genomic sequences: Accessible via JGI Genome Portal (Bxe_A3983) .

Unresolved Questions and Future Directions

  1. Substrate specificity: Does B. xenovorans ubiA accept alternative prenyl donors (e.g., farnesyl or geranyl diphosphate)?

  2. Pathway integration: How does ubiA activity interact with benzoate/coenzyme A (CoA) pathways in LB400 ?

  3. Biotechnological optimization: Can recombinant ubiA be engineered for industrial production of prenylated compounds?

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquotting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type preferences, please inform us, and we will prioritize development with the specified tag.
Synonyms
ubiA; Bxeno_A0478; Bxe_A3983; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Paraburkholderia xenovorans (strain LB400)
Target Names
ubiA
Target Protein Sequence
MFARLPLYLRLVRMDKPIGSLLLLWPTLNALWIASDGRPSLPLLVIFTVGTVLMRSAGCA INDYADRDFDRYVRRTENRPITSGKIRAWEAVALAAALSLLAFLLILPLNALTKELSVAA LFVAGSYPFTKRFFAIPQAYLGIAFGFGIPMAFAAIQNHVPMLAWVMLLANVFWSVAYDT EYAMVDRDDDIKIGIRTSALTFGRFDVAAIMLCYAVTLGIYVGIGVLLGFGALYWLGWAA AAGCAIYHYTLIRNRERMACFAAFRHNNWLGGALFAGIAAHYAATWF
Uniprot No.

Target Background

Function
Catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. Mediates the second step in the final reaction sequence of ubiquinone-8 (UQ-8) biosynthesis. This step involves the condensation of the polyisoprenoid side chain with PHB, generating the first membrane-bound Q intermediate 3-octaprenyl-4-hydroxybenzoate.
Database Links
Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic function of 4-hydroxybenzoate octaprenyltransferase (ubiA) in Burkholderia xenovorans?

4-hydroxybenzoate octaprenyltransferase (ubiA) from Burkholderia xenovorans catalyzes a critical step in ubiquinone (coenzyme Q) biosynthesis by transferring a prenyl group to 4-hydroxybenzoate. This enzyme belongs to the EC 2.5.1.- class of transferases and is alternatively known as 4-HB polyprenyltransferase . The reaction is essential for respiratory electron transport chain function in B. xenovorans. Within the bacterial cellular machinery, ubiA operates at the interface of primary metabolism and specialized metabolic pathways, contributing to the organism's remarkable adaptability to various environmental conditions and its capacity for degrading aromatic compounds like PCBs .

What are the structural characteristics of the recombinant B. xenovorans ubiA protein?

The recombinant B. xenovorans ubiA protein (UniProt accession: Q145H3) consists of 287 amino acids with a structure typical of membrane-bound prenyltransferases. The full amino acid sequence begins with MFARLPLYLRLVRMDKPIGS and contains multiple transmembrane regions that anchor the protein to the membrane . Structural analysis reveals conserved aspartate-rich motifs that participate in catalysis by coordinating divalent metal ions (typically Mg²⁺) needed for substrate binding and enzymatic activity. Hydropathy profile analysis indicates 8-9 transmembrane segments with catalytic sites positioned to access both the hydroxybenzoate substrate and prenyl pyrophosphate from opposite sides of the membrane.

How should researchers prepare and store recombinant B. xenovorans ubiA for maximum stability?

For optimal stability, recombinant B. xenovorans ubiA should be stored in a Tris-based buffer containing 50% glycerol at -20°C for regular use, or at -80°C for extended storage periods . To minimize protein degradation, it's crucial to avoid repeated freeze-thaw cycles which can significantly reduce enzymatic activity. Working aliquots can be stored at 4°C for up to one week, but not longer, as membrane proteins are particularly susceptible to aggregation and denaturation. Before any enzymatic assays, centrifuge the protein briefly (5 minutes at 10,000 × g) to remove any potential aggregates. For long-term experiments, prepare multiple small-volume aliquots (20-50 μL) to avoid repeatedly thawing the entire stock.

What expression systems are most effective for producing active recombinant B. xenovorans ubiA?

For producing active recombinant B. xenovorans ubiA, E. coli-based expression systems with membrane protein optimization modifications yield the best results. Specifically, C41(DE3) or C43(DE3) strains derived from BL21(DE3) are preferred as they contain mutations that prevent the toxicity often associated with membrane protein overexpression. Expression should utilize vectors with inducible promoters (such as T7) and moderate induction conditions (0.1-0.5 mM IPTG at 16-20°C for 16-20 hours) to allow proper membrane insertion . Addition of 0.5-1% glycerol to the culture medium enhances membrane protein folding. For functional studies, co-expression with B. xenovorans phosphopantetheinyl transferase may increase the proportion of active enzyme by ensuring proper post-translational modification.

What are the optimal purification strategies for maintaining enzymatic activity of B. xenovorans ubiA?

Purification of B. xenovorans ubiA requires specialized approaches that preserve the native membrane environment essential for catalytic activity. The recommended workflow begins with cell lysis using either a French press or sonication in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, and protease inhibitors. Membrane fractions are isolated through differential centrifugation (40,000 × g for 1 hour) followed by solubilization using mild detergents such as 1% n-dodecyl-β-D-maltoside (DDM) or 1% digitonin for 2 hours at 4°C . For affinity purification, the recombinant protein equipped with an appropriate tag can be captured using standard methods, but all buffers must contain 0.05-0.1% detergent to prevent aggregation. Size exclusion chromatography as a final purification step helps obtain homogeneous protein preparations suitable for activity assays and structural studies.

What advanced approaches can address protein instability during ubiA purification?

For researchers encountering instability issues during ubiA purification, several advanced approaches can significantly improve results. Nanodiscs or styrene-maleic acid lipid particles (SMALPs) provide alternative membrane-mimetic environments that better preserve native protein conformation compared to detergent micelles. Implementation requires reconstituting the detergent-solubilized ubiA with MSP1D1 scaffold protein and E. coli lipids at specific ratios (typically 1:2:60 protein:MSP:lipid molar ratio), followed by detergent removal using Bio-Beads . Additionally, incorporation of specific lipids from B. xenovorans into the purification buffers can enhance stability by mimicking the native membrane environment. Thermal shift assays using differential scanning fluorimetry can help identify optimal buffer compositions that maximize stability, with successful formulations typically including combinations of glycerol (10-20%), specific lipids (0.1-0.5 mg/mL), and stabilizing agents such as cholesteryl hemisuccinate (CHS).

What are reliable methods for measuring 4-hydroxybenzoate octaprenyltransferase activity?

The standard assay for measuring 4-hydroxybenzoate octaprenyltransferase activity employs radiometric detection using [14C]-labeled substrates. The reaction mixture typically contains purified enzyme (1-5 μg), 50 mM Tris-HCl (pH 7.5), 5 mM MgCl2, 0.1% Triton X-100, 100 μM 4-hydroxybenzoate, and 50 μM [14C]octaprenyl pyrophosphate in a total volume of 100 μL. After incubation at 30°C for 30 minutes, the reaction is terminated by adding 200 μL of ethyl acetate and mixing vigorously . The organic phase containing the radiolabeled product is separated, and radioactivity is measured using a scintillation counter. For non-radioactive alternatives, HPLC-based methods utilizing UV detection at 254 nm can effectively monitor product formation, though this requires larger amounts of enzyme and substrates. A fluorescence-based assay measuring the decrease in intrinsic tryptophan fluorescence upon substrate binding provides a rapid screening method for inhibitor studies.

How can researchers investigate substrate specificity of B. xenovorans ubiA?

To investigate substrate specificity of B. xenovorans ubiA, researchers should employ a systematic approach examining both the aromatic acceptor and prenyl donor components. The experimental design involves preparing a panel of structurally diverse hydroxybenzoate derivatives (3-hydroxybenzoate, 2,4-dihydroxybenzoate, etc.) and various prenyl donors (geranyl pyrophosphate, farnesyl pyrophosphate, etc.) . Reactions are conducted using standardized conditions (50 mM Tris-HCl pH 7.5, 5 mM MgCl2, 0.1% Triton X-100, 30°C) with equivalent substrate concentrations (100 μM). Products are analyzed using HPLC-MS methods to determine relative conversion rates. Kinetic parameters (Km, kcat, kcat/Km) should be determined for each viable substrate pair using initial velocity measurements across multiple substrate concentrations (10-500 μM). Results are typically presented in a substrate specificity matrix table comparing relative activity (%) or catalytic efficiency (kcat/Km) values for each substrate combination.

What advanced kinetic analyses can reveal the reaction mechanism of B. xenovorans ubiA?

Advanced kinetic analyses to elucidate the reaction mechanism of B. xenovorans ubiA should employ steady-state and pre-steady-state approaches. To determine the reaction order, initial velocity studies examining both substrates (4-hydroxybenzoate and octaprenyl pyrophosphate) at 5-7 different concentrations each (ranging from 0.2-5× Km) can establish whether the enzyme follows an ordered or random sequential mechanism . Double-reciprocal (Lineweaver-Burk) plots at varied concentrations of the second substrate reveal characteristic patterns of lines intersecting at specific points. Product inhibition studies using 3-octaprenyl-4-hydroxybenzoate and pyrophosphate provide further evidence of the binding sequence. For transient kinetic analyses, stopped-flow spectroscopy monitoring intrinsic fluorescence changes upon substrate binding can determine association/dissociation rate constants. Isotope partitioning experiments using radioactive substrates help establish the rate-limiting step in the catalytic cycle. Temperature-dependent kinetic measurements (10-40°C) allow calculation of activation parameters (ΔH‡, ΔS‡, ΔG‡) providing insights into the transition state structure.

How is the ubiA gene organized within the B. xenovorans genome?

The ubiA gene in Burkholderia xenovorans is located on the primary chromosome (chromosome 1) as determined by whole genome sequencing. The gene is identified by the ordered locus name Bxeno_A0478 and ORF name Bxe_A3983 . Within the genomic context, ubiA is typically part of a functional cluster containing genes involved in the ubiquinone biosynthetic pathway, including ubiC (chorismate pyruvate-lyase), ubiD (3-octaprenyl-4-hydroxybenzoate carboxy-lyase), and ubiB (ubiquinone biosynthesis monooxygenase). The gene spans approximately 864 nucleotides encoding the 287 amino acid protein . Analysis of the promoter region reveals putative binding sites for global regulators involved in responding to oxidative stress, reflecting the enzyme's role in respiratory metabolism and adaptation to environmental conditions. Comparative genomic analysis indicates that the ubiA gene has undergone selective pressure consistent with the essential nature of ubiquinone biosynthesis .

What insights do comparative genomics provide about ubiA conservation across Burkholderia species?

SpeciesGene IDProtein Length (aa)Sequence Identity to B. xenovorans (%)Genomic Context Conservation
B. xenovorans LB400Bxeno_A0478287100Reference
B. cepacia complexVariable285-29082-85Moderate
B. malleiBMA150328678Low
B. pseudomalleiBPSL241328677Low

This pattern of conservation reflects the evolutionary history of Burkholderia species and provides insights into functional adaptations of ubiA to different ecological niches .

How does lateral gene transfer contribute to the evolution of metabolic pathways involving ubiA in B. xenovorans?

Lateral gene transfer (LGT) has played a significant role in shaping metabolic pathways involving ubiA in B. xenovorans. Genomic analysis reveals that more than 20% of the B. xenovorans LB400 genome was acquired through LGT events, contributing to its remarkable metabolic versatility, particularly for aromatic compound degradation . While core metabolic genes like ubiA show evidence of vertical inheritance, the accessory genes that modify or extend these pathways frequently display hallmarks of horizontal acquisition, including atypical nucleotide composition, codon usage bias, and phylogenetic incongruence with species trees. The enzymatic versatility of ubiA may have facilitated the integration of horizontally acquired aromatic degradation pathways by providing metabolic connections between existing and novel biochemical routes. Specifically, the presence of eleven "central aromatic" and twenty "peripheral aromatic" pathways in LB400, among the highest in any sequenced bacterial genome, highlights how LGT has expanded the metabolic capabilities connected to ubiquinone-dependent respiratory chains . The evolutionary trajectory of ubiA in B. xenovorans demonstrates how essential genes can serve as evolutionary anchors for the acquisition and retention of complex metabolic networks via LGT.

What role does ubiA play in the extraordinary PCB-degrading capabilities of B. xenovorans?

The 4-hydroxybenzoate octaprenyltransferase (ubiA) plays a crucial indirect role in the PCB-degrading capabilities of B. xenovorans by supporting the cell's energetic requirements during aromatic compound metabolism. By catalyzing a key step in ubiquinone biosynthesis, ubiA ensures adequate production of this essential electron carrier for respiratory metabolism . During PCB degradation, which is an aerobic process requiring significant energy input, robust electron transport chain function becomes critical. B. xenovorans contains at least eleven "central aromatic" and twenty "peripheral aromatic" degradation pathways, making it one of the most versatile aromatic compound degraders known . These pathways generate intermediates that enter central metabolism, where ubiquinone-dependent respiratory processes are essential for energy conservation. While not directly involved in PCB transformation, ubiA supports these processes by maintaining the electron transport chain integrity, allowing the cell to harvest energy efficiently while metabolizing these challenging xenobiotic compounds.

How does ubiA enzyme function relate to other metabolic pathways in B. xenovorans?

The function of ubiA in B. xenovorans intersects with multiple metabolic pathways, creating a complex network of biochemical interactions. UbiA catalyzes the first committed step in ubiquinone biosynthesis, connecting aromatic amino acid metabolism (via chorismate) to isoprenoid biosynthesis (providing the prenyl donor) . This positions the enzyme at a metabolic crossroads with connections to:

  • Aromatic amino acid biosynthesis: Shares chorismate as a common precursor

  • Isoprenoid metabolism: Utilizes polyprenyl pyrophosphates from the MEP/DOXP pathway

  • Cell envelope biosynthesis: Shares isoprenoid precursors with peptidoglycan biosynthesis

  • Fatty acid metabolism: Coordinated regulation with membrane lipid synthesis

  • Aromatic compound catabolism: Supports energy generation during breakdown of aromatic pollutants

The genomic analysis of B. xenovorans reveals extensive gene duplication and redundancy in metabolic pathways, with 17.6% of proteins having a better paralog within the genome than orthologs in other genomes . This metabolic plasticity allows B. xenovorans to adapt to diverse environmental conditions and utilize a wide range of carbon sources, with ubiA function being central to energy conservation throughout these adaptations.

What regulatory mechanisms control ubiA expression in response to environmental changes?

The expression of ubiA in B. xenovorans is controlled by sophisticated regulatory mechanisms that respond to environmental changes, particularly oxygen availability, carbon source, and oxidative stress. As part of the ubiquinone biosynthetic pathway, ubiA expression increases under aerobic conditions where respiratory metabolism predominates . Transcriptomic analysis of B. xenovorans grown on different carbon sources reveals coordinated regulation of ubiA with genes involved in aromatic compound metabolism, suggesting coupling between substrate utilization and respiratory capacity. The promoter region of ubiA contains putative binding sites for transcription factors sensitive to redox status, including OxyR and SoxR homologs, which can upregulate expression during oxidative stress to maintain electron transport chain function .

Post-transcriptional regulation also plays a role, with small RNAs potentially modulating ubiA translation efficiency under stress conditions. At the protein level, activity may be controlled through feedback inhibition by ubiquinone pathway intermediates or end products. The complex regulatory network controlling ubiA expression exemplifies how B. xenovorans has evolved sophisticated control mechanisms to optimize energy metabolism in response to environmental challenges, contributing to its remarkable adaptability and biodegradation capabilities in diverse ecological niches.

How can protein engineering enhance the catalytic properties of B. xenovorans ubiA?

Protein engineering can significantly enhance the catalytic properties of B. xenovorans ubiA through several strategic approaches. Structure-guided mutagenesis targeting the active site can alter substrate specificity or improve catalytic efficiency. Based on homology modeling with crystallized UbiA from Aeropyrum pernix, mutations of conserved aspartate residues within the DXXXD motifs that coordinate Mg²⁺ can modulate metal binding and catalytic rates . Semi-rational approaches using site-saturation mutagenesis of residues lining the substrate binding pocket can yield variants with expanded acceptor substrate ranges. Additionally, directed evolution strategies employing error-prone PCR combined with high-throughput screening can identify mutations that enhance thermostability or solvent tolerance. Successful engineering efforts should consider:

  • Conserving transmembrane topology while modifying internal residues

  • Maintaining proper membrane association using amphipathic helices

  • Engineering substrate tunnels to accommodate larger prenyl donors

  • Modifying residues at the membrane interface to enhance stability

These approaches have potential applications in developing biocatalysts for synthesizing novel prenylated compounds with pharmaceutical applications, particularly antimicrobial and anticancer agents derived from modified ubiquinone analogs.

What are the methodological challenges in structural studies of B. xenovorans ubiA and how can they be addressed?

Structural studies of B. xenovorans ubiA face significant methodological challenges due to its integral membrane protein nature. These challenges include obtaining sufficient quantities of properly folded protein, maintaining stability during purification, and forming suitable crystals for X-ray diffraction studies . To address these obstacles, researchers can employ a multi-faceted strategy. For protein expression, utilize specialized E. coli strains like C41(DE3) with fusion tags that enhance expression and solubility (e.g., MISTIC or GFP fusion). Stability during purification can be improved through amphipathic polymers like amphipols or nanodiscs that provide a more native-like membrane environment than detergent micelles.

For crystallization, lipidic cubic phase (LCP) methods have proven particularly successful for membrane proteins similar to ubiA. Alternatively, cryo-electron microscopy (cryo-EM) can circumvent crystallization difficulties altogether. Recent advances in single-particle cryo-EM have made it possible to achieve near-atomic resolution for membrane proteins smaller than 100 kDa by using approaches such as antibody fragment (Fab) complexation to increase effective molecular size. For proteins recalcitrant to these methods, computational approaches like AlphaFold2 combined with molecular dynamics simulations in explicit membrane environments can provide structural insights, especially when constrained by experimental data from limited proteolysis, hydrogen-deuterium exchange mass spectrometry, or cross-linking studies.

How can systems biology approaches integrate ubiA function into genome-scale metabolic models of B. xenovorans?

Systems biology approaches can effectively integrate ubiA function into genome-scale metabolic models (GSMMs) of B. xenovorans, providing comprehensive insights into cellular metabolism and guiding experimental design. To construct an accurate GSMM incorporating ubiA, researchers should begin with functional annotation verification using proteomics and metabolomics data to confirm the predicted reactions catalyzed by the enzyme . Flux balance analysis (FBA) can then be used to predict how changes in ubiA activity affect global metabolic fluxes, particularly under different growth conditions or during PCB degradation. Constraints-based modeling approaches should incorporate experimentally determined kinetic parameters of ubiA (Km, kcat, inhibition constants) to improve prediction accuracy.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.