Recombinant Burkholderia xenovorans Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Description

Introduction to Burkholderia xenovorans and DsbB System

Burkholderia xenovorans is a non-pathogenic soil bacterium with remarkable metabolic capabilities, particularly known for its ability to degrade polychlorinated biphenyls (PCBs), toxic organic compounds that persist in the environment . The LB400 strain of B. xenovorans, isolated from a PCB-contaminated landfill in New York over two decades ago, has been extensively studied due to its capacity to oxidize more than 20 different PCB congeners . This bacterium possesses one of the largest prokaryotic genomes, approximately 9.7 Mb, distributed across three circular replicons: chromosome 1 (4.90 Mbp), chromosome 2 (3.36 Mbp), and a megaplasmid (1.47 Mbp) .

Within this complex genomic landscape exists the disulfide bond formation (Dsb) system, a crucial cellular machinery responsible for the proper folding of many proteins, particularly those secreted to the periplasm. The DsbA-DsbB system represents a key component of this machinery, with DsbB serving as a membrane-bound oxidoreductase that functions in concert with the periplasmic DsbA protein to catalyze disulfide bond formation . While much of our understanding of the Dsb system comes from studies in Escherichia coli and other bacteria, evidence suggests that the B. xenovorans DsbB plays similar vital roles in protein folding and cellular functions.

Functional Role in Disulfide Bond Formation

The DsbB protein plays a critical role in the bacterial disulfide bond formation pathway, functioning as part of the DsbA-DsbB system. This system is essential for the proper folding of many secreted and membrane proteins that require disulfide bonds for their structural integrity and function .

The functional significance of DsbB can be understood through studies of DsbB mutations in related bacteria. In Burkholderia cepacia, a close relative of B. xenovorans, DsbB mutations result in significant phenotypic changes, including defects in extracellular protease production, alkaline phosphatase activity, and bacterial motility . These findings highlight the essential role of DsbB in maintaining proper protein folding and function across various cellular processes.

The mechanism of DsbB action involves a cascade of redox reactions. DsbB re-oxidizes DsbA after DsbA has transferred its disulfide bond to substrate proteins. This regeneration of oxidized DsbA allows the system to catalyze multiple rounds of disulfide bond formation in substrate proteins . In this process, DsbB itself becomes reduced and must be re-oxidized by transferring electrons to the respiratory chain, typically via ubiquinone under aerobic conditions.

Comparison with DsbB Proteins in Other Bacteria

The DsbB protein is conserved across various bacterial species, although with differences in sequence and specific functions. Comparative analysis provides valuable insights into the evolutionary conservation and specialization of this important protein.

In Escherichia coli, where the Dsb system has been most thoroughly characterized, DsbB functions primarily in the oxidative protein folding pathway. Mutations in the E. coli dsbB gene confer pleiotropic phenotypes, including sensitivity to benzylpenicillin and inability to support plaque formation of filamentous phages . These phenotypes reflect the essential role of DsbB in maintaining proper disulfide bond formation in various secreted proteins.

In Burkholderia cepacia, DsbB has been implicated not only in protein folding but also in metal resistance and antibiotic tolerance. Specifically, mutations in the DsbA-DsbB system increase sensitivity to cadmium (Cd²⁺) and zinc (Zn²⁺), as well as to various antibiotics including beta-lactams, kanamycin, erythromycin, novobiocin, ofloxacin, and sodium dodecyl sulfate . This suggests that the DsbA-DsbB system may be involved in the formation of metal efflux systems and multi-drug resistance mechanisms.

Table 2: Comparison of DsbB Functions Across Bacterial Species

Bacterial SpeciesPrimary FunctionsAssociated PhenotypesReference
Burkholderia xenovoransDisulfide bond formation in secreted proteinsNot fully characterized
Burkholderia cepaciaDisulfide bond formation, metal resistance, antibiotic toleranceDefects in protease production, motility, and alkaline phosphatase activity
Escherichia coliOxidative protein foldingSensitivity to benzylpenicillin, defects in phage plaque formation

Research Applications of Recombinant B. xenovorans DsbB

Recombinant Burkholderia xenovorans Disulfide Bond Formation Protein B (DsbB) has significant potential for various research applications. The availability of this protein in recombinant form, as indicated by commercial sources, facilitates its use in structural, functional, and applied studies .

One important application is in enzyme-linked immunosorbent assays (ELISA), which can be used to detect and quantify specific antigens or antibodies. Recombinant B. xenovorans DsbB can serve as a standard or control in such assays, particularly in studies focused on bacterial protein folding and disulfide bond formation .

Additionally, recombinant DsbB could be valuable for studying the mechanism of disulfide bond formation and for developing potential inhibitors of this process. Such inhibitors might have applications in antimicrobial development, as the Dsb system is essential for the virulence of many pathogenic bacteria.

In biotechnology, understanding the function of DsbB in B. xenovorans could contribute to optimizing the expression and folding of recombinant proteins that require disulfide bonds for their stability and activity. This is particularly relevant for the production of therapeutic proteins and industrial enzymes in bacterial expression systems.

Role in B. xenovorans Metabolism and Environmental Adaptation

The DsbB protein likely plays an important role in supporting the remarkable metabolic versatility of B. xenovorans, particularly its ability to degrade xenobiotic compounds like PCBs. While direct evidence linking DsbB to these metabolic pathways is limited in the available research, the protein's function in ensuring proper folding of secreted enzymes suggests its indirect contribution to these processes.

B. xenovorans LB400 possesses diverse catabolic capabilities, including multiple pathways for degrading aromatic compounds . Many of the enzymes involved in these pathways are likely to be secreted or membrane-associated proteins that may require proper disulfide bond formation for their function. By ensuring the correct folding of these enzymes, DsbB could be supporting the bacterium's ability to metabolize complex organic compounds.

Furthermore, the bacterium's adaptation to its environmental niche in soil rhizospheres may be facilitated by proteins whose proper folding depends on the DsbA-DsbB system. In B. cepacia, mutations in this system affect protease production and motility , which are important factors for bacterial survival and competition in soil environments. Similar functions might be attributed to the DsbA-DsbB system in B. xenovorans.

Potential Involvement in PCB Degradation Pathways

Given B. xenovorans LB400's remarkable capability to transform PCBs and their derivatives, it is worth exploring the potential connection between the DsbB protein and these degradation pathways. Research has shown that B. xenovorans LB400 can transform hydroxylated derivatives of 2,5-dichlorobiphenyl (2,5-DCB) when grown on biphenyl as a carbon source, with the transformation linked to the expression of genes in the biphenyl pathway (bph genes) .

While there is no direct evidence in the available research linking DsbB to PCB degradation, the protein may indirectly support these processes by ensuring the proper folding of enzymes involved in the biphenyl pathway. The transformation of hydroxylated PCB derivatives requires functional enzymes that may depend on correct disulfide bond formation for their activity.

Additionally, B. xenovorans possesses multiple aromatic degradation pathways distributed across its three replicons, including the biphenyl pathway for PCB degradation and an aerobic CoA ligation-dependent benzoate pathway . The proper functioning of these pathways may be influenced by the DsbA-DsbB system's role in protein folding and stability.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please include any such requests in your order remarks, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please let us know, and we will prioritize its development.
Synonyms
dsbB; Bxeno_A3457; Bxe_A0951; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Paraburkholderia xenovorans (strain LB400)
Target Names
dsbB
Target Protein Sequence
MNNDTAMLRRERSLLVLLALICLALVGGALYLQYFLHEDPCPLCIIQRYFFLLIAIFAFL GARFNSWRGVRLLEVLAALSALGGIVTAARHVYVQANPGFSCGFDALQPLVDSLPPAHWL PGVFKVAGLCETAYPPILGLTLPQWSLVAFVIAFIPLALSLVRNRRRIA
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain periplasmic proteins. It functions by oxidizing the DsbA protein.
Database Links
Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic function of DsbB in Burkholderia xenovorans?

DsbB in B. xenovorans functions as a membrane protein essential for the oxidative protein folding pathway. It specifically reoxidizes DsbA after DsbA has transferred its disulfide bond to substrate proteins in the periplasm. This recycling process is critical for maintaining the continuous formation of disulfide bonds in newly synthesized proteins. DsbB connects the oxidative folding machinery to the respiratory chain through interactions with quinones, allowing electron transfer to occur from reduced DsbA to the quinone pool .

The process involves a cascade of thiol-disulfide exchange reactions where DsbB contains two pairs of essential catalytic cysteines (typically Cys41–Cys44 and Cys104–Cys130) located in its periplasmic loops. These cysteine pairs facilitate electron flow from reduced DsbA to oxidized quinones, ultimately ensuring that DsbA remains in its oxidized, active state to catalyze disulfide bond formation in substrate proteins .

What is the genomic context of dsbB in Burkholderia xenovorans LB400?

In B. xenovorans LB400, the genomic organization of dsbB appears to follow patterns observed in some other bacteria where disulfide bond formation is important for protein stability and function. While some bacteria contain an operon with linked dsbA and dsbB genes that seem substrate-specific, organisms like B. xenovorans that produce numerous proteins with disulfide bonds typically have dsbA and dsbB genes that are not genetically linked .

The arrangement of these genes in the B. xenovorans genome likely reflects the organism's adaptation to its ecological niche. As an organism capable of degrading polychlorinated biphenyls (PCBs), B. xenovorans produces specialized enzymes, some of which may require proper disulfide bond formation for stability and activity. This environmental adaptation may have influenced the evolution and genomic context of its disulfide bond formation machinery .

What are the optimal expression systems for recombinant B. xenovorans DsbB production?

For recombinant production of B. xenovorans DsbB, expression systems must address the challenges of membrane protein expression. E. coli-based systems using vectors with tunable promoters (such as pET or pBAD series) are often effective for initial expression trials. The key factors for successful expression include:

  • Host strain selection: C41(DE3) or C43(DE3) E. coli strains often show improved membrane protein expression compared to standard BL21(DE3)

  • Induction conditions: Lower temperatures (16-25°C) and reduced inducer concentrations minimize aggregation

  • Fusion partners: N-terminal fusions with MBP or thioredoxin can improve solubility

  • Detergent screening: A panel of detergents (DDM, LDAO, FC-12) should be tested for optimal extraction and stability

For functional studies, co-expression with B. xenovorans DsbA may be necessary to maintain the native interaction network. Purification typically requires a two-step protocol combining immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography in the presence of suitable detergents .

How can researchers accurately measure the catalytic activity of recombinant DsbB?

The catalytic activity of recombinant B. xenovorans DsbB can be assessed through several complementary approaches:

  • Ubiquinone reduction assay: Monitoring the decrease in absorbance at 275 nm as ubiquinone is reduced during DsbB catalysis

  • Oxygen consumption assay: Using an oxygen electrode to measure the rate of oxygen consumption when DsbB transfers electrons to the respiratory chain

  • DsbA reoxidation assay: Tracking the reoxidation of reduced DsbA by DsbB using thiol-reactive fluorescent probes

  • Coupled enzyme assays: Monitoring disulfide bond formation in model substrates when both DsbA and DsbB are present

For quantitative analysis, enzyme kinetics parameters (Km, kcat) should be determined under varying substrate and enzyme concentrations. A typical reaction buffer contains 50 mM Tris-HCl (pH 8.0), 100 mM NaCl, and 0.1% detergent. Temperature optimization is essential, as B. xenovorans proteins may exhibit different temperature optima compared to mesophilic counterparts .

What mutagenesis strategies help identify critical residues in B. xenovorans DsbB?

Targeted mutagenesis strategies for identifying critical residues in B. xenovorans DsbB should focus on:

  • Catalytic cysteine residues: Alanine substitutions of the conserved cysteines in both periplasmic loops (equivalent to Cys41-Cys44 and Cys104-Cys130 in E. coli) to assess their role in the catalytic mechanism

  • Quinone-binding residues: Mutations in residues lining the transmembrane helical bundle that interact with the quinone cofactor

  • DsbA interaction interface: Alanine scanning of surface-exposed residues potentially involved in DsbA recognition

  • Transmembrane segment residues: Substitutions that could affect membrane integration and protein stability

Historical studies with E. coli DsbB have shown dominant negative effects when cysteine 33 is substituted with either tyrosine or serine, demonstrating how single mutations can significantly impact function . Similar approaches with B. xenovorans DsbB could identify species-specific functional determinants. Complementation studies in dsbB-deficient bacterial strains provide a functional readout for the impact of these mutations.

How does the quinone specificity of B. xenovorans DsbB influence its activity in different growth conditions?

The quinone specificity of B. xenovorans DsbB likely plays a critical role in adapting disulfide bond formation to varying growth conditions. In E. coli, DsbB can interact with both ubiquinone (under aerobic conditions) and menaquinone (under anaerobic conditions), maintaining disulfide bond formation capacity regardless of oxygen availability .

For B. xenovorans, which can degrade PCBs in various environmental conditions, the quinone specificity of DsbB may be particularly important for maintaining enzyme function across changing oxygen levels. Research approaches to investigate this include:

  • Anaerobic vs. aerobic activity assays with purified recombinant DsbB

  • Quinone extraction and analysis from B. xenovorans grown under different conditions

  • Reconstitution experiments with different quinones to determine kinetic parameters

  • Site-directed mutagenesis of predicted quinone-binding residues to alter specificity

Studies with E. coli have shown that DsbB mutants with reduced affinity for ubiquinone display deficiencies in DsbA oxidation and disulfide bond formation . Similar principles likely apply to B. xenovorans DsbB, with adaptive mechanisms potentially evolved to support its unique metabolic capabilities in PCB degradation.

What is the role of DsbB in supporting B. xenovorans' ability to degrade polychlorinated biphenyls?

B. xenovorans LB400 is renowned for its ability to degrade polychlorinated biphenyls (PCBs), and its disulfide bond formation machinery likely plays an important role in maintaining the structural integrity of enzymes involved in this process. The connection between DsbB function and PCB degradation may involve:

  • Stabilization of key extracellular or periplasmic enzymes in the biphenyl degradation pathway through proper disulfide bond formation

  • Support for stress-response proteins needed during exposure to PCBs and their metabolites

  • Maintenance of membrane integrity during growth on toxic substrates

  • Potential redox sensing functions linking environmental conditions to degradative capacity

The biphenyl pathway enzymes in B. xenovorans LB400 likely include exported proteins that may require disulfide bonds for stability, especially when the bacterium grows on biphenyl or PCBs as carbon sources . Comparative studies of wild-type and dsbB-deficient strains could reveal specific deficiencies in PCB degradation linked to improper disulfide bond formation.

How does B. xenovorans DsbB compare with VKOR-based oxidative systems found in other bacteria?

Some bacteria utilize Vitamin K epoxide reductase (VKOR) instead of DsbB to reoxidize DsbA in their disulfide bond formation pathways. A comparative analysis between B. xenovorans DsbB and VKOR-based systems reveals:

  • Structural differences: While DsbB has four transmembrane segments, VKOR typically contains five transmembrane segments with different arrangements of catalytic cysteines

  • Evolutionary distribution: VKOR is widespread across domains of life including prokaryotes, plants, and vertebrates, while DsbB is primarily found in bacteria

  • Mechanistic distinctions: Both systems connect to the respiratory chain, but VKOR has evolved from an ancient enzyme family with different evolutionary origins than DsbB

  • Inhibitor sensitivity: VKOR is the target of warfarin, while DsbB has different inhibitor profiles

The presence of DsbB rather than VKOR in B. xenovorans likely reflects its evolutionary history and specific requirements for disulfide bond formation in its ecological niche. Comparative genomic analysis across Burkholderia species could reveal patterns of conservation or horizontal gene transfer that shaped the evolution of disulfide bond formation pathways in this genus.

What are the critical considerations for structural characterization of B. xenovorans DsbB?

Structural characterization of B. xenovorans DsbB presents several challenges due to its membrane-embedded nature. Key considerations include:

  • Protein preparation:

    • Selection of appropriate detergents that maintain native structure

    • Ensuring homogeneity and stability during purification

    • Consideration of lipid composition for reconstitution

  • Structural methods optimization:

    • X-ray crystallography: Lipidic cubic phase or bicelle crystallization

    • Cryo-EM: Nanodisc reconstitution for single-particle analysis

    • NMR: Isotope labeling strategies for membrane proteins

  • Functional state capture:

    • Co-purification with interaction partners (DsbA)

    • Stabilization of different catalytic intermediates

    • Cross-linking approaches to capture transient states

  • Validation strategies:

    • Complementary biophysical techniques (CD, FTIR, SAXS)

    • Activity correlation with structural features

    • Computational modeling and dynamics simulations

Previous studies of E. coli DsbB have shown that the helical bundle engulfs a quinone molecule positioned near the CXXC motif . Similar structural features would be expected in B. xenovorans DsbB, though species-specific adaptations may exist related to its unique ecological niche.

How can researchers effectively study DsbB-DsbA interactions in B. xenovorans?

Investigating the interactions between B. xenovorans DsbB and DsbA requires specialized approaches due to the transient nature of their interaction and the membrane localization of DsbB. Effective methodologies include:

  • Biochemical approaches:

    • Pull-down assays using tagged versions of either protein

    • Co-immunoprecipitation from native membranes

    • Surface plasmon resonance with detergent-solubilized or nanodisc-reconstituted DsbB

  • Structural approaches:

    • Chemical cross-linking followed by mass spectrometry

    • Hydrogen-deuterium exchange mass spectrometry

    • Co-crystallization attempts with stabilized intermediates

  • Biophysical interaction analysis:

    • Isothermal titration calorimetry for thermodynamic parameters

    • Microscale thermophoresis for binding affinity determination

    • Förster resonance energy transfer between labeled proteins

  • Functional interaction characterization:

    • Mixed disulfide trap mutants (e.g., DsbA C33S) to capture interaction complexes

    • Kinetic analysis of interdependent activities

    • Complementation studies in heterologous systems

Historical studies have demonstrated that dominant negative effects occur when cysteine 33 in DsbA is substituted with tyrosine or serine, affecting disulfide bond formation capacity . Similar approaches could be employed to trap and characterize B. xenovorans DsbB-DsbA complexes.

What strategies can address challenges in expressing functional recombinant B. xenovorans DsbB?

Expression of functional recombinant B. xenovorans DsbB presents several challenges typical of membrane proteins, requiring specialized strategies:

  • Expression optimization:

    StrategyImplementationExpected Outcome
    Promoter modulationTest IPTG-inducible vs. auto-induction systemsPrevent toxic overexpression
    Growth temperature variationExpress at 16-30°CReduce inclusion body formation
    Host strain engineeringUse C41/C43(DE3) or SHuffle strainsImproved membrane protein folding
    Codon optimizationAdapt to E. coli codon usageEnhanced translation efficiency
  • Solubilization and purification:

    Detergent ClassExamplesAdvantages
    MaltosidesDDM, UDMMild, maintain protein-protein interactions
    GlycosidesOG, NGEffective solubilization
    ZwitterionicLDAO, FC-12Often yield monodisperse preparations
    AmphipolsA8-35, PMALStabilize without free micelles
  • Functional verification:

    • Quinone binding assays to confirm cofactor association

    • DsbA reoxidation activity measurements

    • Complementation of E. coli dsbB-null mutants

    • Monitoring disulfide-dependent folding of model substrates

  • Alternative expression systems:

    • Cell-free expression with supplied lipids/detergents

    • Bacillus or Pseudomonas-based expression systems (closer to native)

    • Yeast (P. pastoris) for higher eukaryotic-like membrane composition

Studies have shown that mutations affecting quinone binding in DsbB display deficiency in DsbA oxidation and disulfide bond formation . Therefore, maintaining the quinone-binding capacity during recombinant expression is critical for obtaining functionally relevant DsbB preparations.

How can B. xenovorans DsbB be utilized for enhanced recombinant protein production requiring disulfide bonds?

B. xenovorans DsbB could be engineered for enhanced recombinant protein production systems through several strategies:

  • Heterologous co-expression systems:

    • Co-expression of B. xenovorans DsbB-DsbA with target proteins in E. coli

    • Engineering of cytoplasmic disulfide formation using modified DsbB variants

    • Creation of specialized strains with optimized oxidative folding compartments

  • Strain engineering approaches:

    • Integration of B. xenovorans dsbB into production strains under controlled promoters

    • Balance of expression levels between DsbB, DsbA and target proteins

    • Modified subcellular targeting to enhance proximity to target proteins

  • Process optimization:

    • Redox environment modulation during protein expression

    • Temperature and induction profiles tailored to DsbB activity

    • Feeding strategies to maintain optimal quinone pools

  • Protein engineering applications:

    • Fusion constructs linking DsbB activity to target protein folding

    • Substrate specificity modification for improved interaction with non-native targets

    • Stability enhancement for industrial process compatibility

Laboratory-based evolution and design experiments have previously demonstrated the feasibility of creating synthetic disulfide bond formation machineries in E. coli . Similar approaches using B. xenovorans DsbB could potentially yield systems with unique properties advantageous for certain target proteins, particularly those involved in xenobiotic compound degradation.

What insights can comparative analysis between B. xenovorans DsbB and other bacterial DsbB proteins provide for protein engineering?

Comparative analysis of B. xenovorans DsbB with other bacterial homologs provides valuable insights for protein engineering:

  • Adaptation mechanisms:

    • Temperature adaptations in catalytic regions

    • Substrate specificity determinants across species

    • Quinone preference variations linked to ecological niches

  • Evolutionary conservation patterns:

    • Core catalytic elements versus variable regions

    • Co-evolution patterns with DsbA partners

    • Taxonomic distribution suggesting functional specialization

  • Structure-function relationships:

    • Correlation between sequence diversity and functional parameters

    • Identification of species-specific regulatory elements

    • Mapping of environmental adaptations to structural features

  • Engineering targets:

    • Chimeric proteins combining beneficial features from multiple species

    • Rational design based on comparative structural models

    • Directed evolution focused on identified variable regions

The diverse environments that different bacteria inhabit, from the PCB-contaminated soils where B. xenovorans thrives to the extreme conditions where some Archaea containing disulfide bond machinery exist, have likely driven adaptations in their DsbB proteins . These adaptations provide natural experiments that can inform protein engineering efforts aimed at enhancing disulfide bond formation under specialized conditions.

How might B. xenovorans DsbB function be affected by environmental contaminants and stress conditions?

The function of B. xenovorans DsbB under environmental stress conditions is particularly relevant given the organism's role in PCB degradation. Key considerations include:

  • Oxidative stress effects:

    • Impact of reactive oxygen species on DsbB's catalytic cysteines

    • Potential shifting of cellular redox balance affecting DsbB function

    • Compensatory mechanisms during oxidative challenge

  • Chemical contaminant interactions:

    • Direct effects of PCBs and metabolites on DsbB structure and function

    • Altered quinone pools affecting DsbB redox cycling

    • Membrane fluidity changes impacting DsbB activity

  • Temperature and pH adaptations:

    • Stability and activity profiles under environmental fluctuations

    • Conformational changes affecting substrate recognition

    • Thermal stress impacts on DsbB-DsbA interaction dynamics

  • Nutritional stress responses:

    • Carbon source availability effects on DsbB expression

    • Electron transport chain adaptations affecting DsbB function

    • Integration with general stress response pathways

Research has shown that the PCB-degrading capacity of B. xenovorans is affected by growth conditions and carbon sources . The expression and function of proteins in the disulfide bond formation pathway, including DsbB, likely play important roles in maintaining cellular function under these challenging conditions. Understanding these adaptations could provide insights for both bioremediation applications and protein engineering efforts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.