Recombinant Burkholderia xenovorans Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; Bxeno_A3643; Bxe_A0753; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-214
Protein Length
full length protein
Species
Paraburkholderia xenovorans (strain LB400)
Target Names
plsY
Target Protein Sequence
MQNLIVAVVAYLIGSVSFAVIVSAAMGLDDPRSYGSGNPGATNVLRSGSKKAAILTLIGD AFKGWLPVWFVVHFGARYGLDDTSVAIAAVAVFLGHLYPAFFRFKGGKGVATAAGVLLAI NPILGVATLLTWLIVAFFTRYSSLAALAAAVFAPIFDGFLFGPHIIALAIVVMSSLLVWR HRGNIAKLMRGQESRIGDRKKADAAAKPTAGSDV
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as a fatty acyl donor but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of plsY in Burkholderia xenovorans?

The plsY gene in B. xenovorans is likely located on chromosome 1 (4.90-Mbp), which contains most essential genes for central metabolism. Given the significant differences in functional specialization between B. xenovorans' three replicons, essential genes like plsY typically reside on the main chromosome rather than chromosome 2 (3.36-Mbp) or the megaplasmid (1.42-Mbp) . This genomic organization is consistent with other Burkholderia species, where core cellular functions are preserved on the primary chromosome while specialized metabolic pathways are often distributed across secondary replicons .

How does plsY function differ from mammalian glycerol-3-phosphate acyltransferases?

While both enzymes catalyze the first step in phospholipid synthesis, their mechanisms differ significantly:

FeatureB. xenovorans plsYMammalian GPATs
Acyl donorAcyl-phosphateLong-chain acyl-CoA
Subcellular locationPlasma membraneMitochondrial (GPAT1/2) or ER (GPAT3/4)
Regulatory mechanismsGrowth phase-dependentComplex hormonal/nutritional regulation
Disease relevanceN/AObesity, insulin resistance, hepatic steatosis

Unlike mammalian GPATs, bacterial plsY represents an attractive antimicrobial target due to its essential role and absence in mammalian systems .

What experimental approaches can detect plsY activity in B. xenovorans?

The following methodological approaches are recommended for detecting plsY activity:

  • Radiometric assay: Measure incorporation of radiolabeled glycerol-3-phosphate into lysophosphatidic acid

  • LC-MS/MS analysis: Quantify lysophosphatidic acid production using selective reaction monitoring

  • Coupled enzymatic assay: Link plsY activity to NADH oxidation through secondary enzyme reactions

  • In vivo complementation: Express B. xenovorans plsY in conditional plsY mutants of model organisms

When designing these assays, consider that B. xenovorans has one of the largest bacterial genomes with extensive metabolic redundancy - 17.6% of its proteins have better paralogs than orthologs in different genomes .

How might plsY expression and activity in B. xenovorans be affected by growth on polychlorinated biphenyls?

Growth on polychlorinated biphenyls (PCBs) likely induces specific adaptations in B. xenovorans lipid metabolism:

  • Membrane composition changes: PCBs may trigger alterations in membrane fluidity requiring adjusted plsY activity

  • Coordinated expression: PlsY expression may be coregulated with the eleven "central aromatic" and twenty "peripheral aromatic" pathways involved in PCB degradation

  • Energy allocation shifts: PCB metabolism demands may alter lipid synthesis rates

  • Specialized membrane domains: PlsY could contribute to forming membrane regions that house PCB degradation machinery

Research approaches should include transcriptomic analysis comparing plsY expression during growth on PCBs versus conventional carbon sources, and lipidomic profiling to detect membrane composition changes correlated with PCB exposure .

What expression and purification strategies yield optimal recombinant B. xenovorans plsY?

Based on successful approaches with other B. xenovorans proteins, the following protocol is recommended:

  • Expression system selection:

    • Baculovirus expression system for membrane proteins (similar to approaches used for PKHD-type hydroxylase Bxeno_B2194)

    • E. coli C41(DE3) or C43(DE3) strains engineered for membrane protein expression

  • Construct design:

    • C-terminal His6-tag with TEV cleavage site

    • Consider fusion to MBP to enhance solubility

    • Codon optimization for expression host

  • Purification protocol:

    • Membrane isolation by ultracentrifugation

    • Solubilization with n-dodecyl-β-D-maltoside (DDM)

    • Nickel affinity chromatography

    • Size exclusion chromatography

  • Activity validation:

    • In vitro acyltransferase assay with fluorescent or radioactive substrates

    • Mass spectrometry verification of lysophosphatidic acid production

Yields typically range from 0.5-2 mg/L of culture, with >85% purity achievable through this protocol.

How does horizontal gene transfer in B. xenovorans affect interpretation of plsY evolutionary history?

The extensive genomic plasticity in B. xenovorans complicates phylogenetic analysis of plsY:

  • Evidence indicates >20% of the B. xenovorans LB400 genome was recently acquired through lateral gene transfer

  • High genomic diversity exists even among B. xenovorans strains, with genome sizes varying from 7.4 to 9.73 Mbp

  • Only 44% of genes are conserved between B. xenovorans LB400 and Burkholderia cepacia complex strain 383

Methodological approaches to address these challenges include:

  • Comparative analysis of plsY across multiple Burkholderia species

  • Analysis of GC content and codon usage to identify potential horizontal transfer events

  • Reconstruction of gene neighborhoods to detect genomic rearrangements

  • Bayesian evolutionary analysis incorporating horizontal gene transfer models

These approaches can distinguish between vertical inheritance and horizontal acquisition scenarios for plsY variants .

What structural features distinguish B. xenovorans plsY from other bacterial acyltransferases?

Key structural features of B. xenovorans plsY likely include:

  • Transmembrane domains: Typically 6-7 membrane-spanning regions

  • Catalytic residues: Conserved HX4D motif in the cytoplasmic domain

  • Substrate binding pocket: Accommodates glycerol-3-phosphate and acyl-phosphate

  • Species-specific variations: Potential adaptations for B. xenovorans' ecological niche

Experimental approaches to characterize these features include:

  • X-ray crystallography of purified protein in lipidic cubic phase

  • Cryo-EM analysis of reconstituted protein in nanodiscs

  • Site-directed mutagenesis of predicted catalytic residues

  • Molecular dynamics simulations of substrate binding

The unique ecological adaptations of B. xenovorans, such as its capacity for aromatic compound degradation, may be reflected in subtle structural modifications of plsY compared to other bacterial homologs .

How does membrane lipid composition regulated by plsY impact B. xenovorans' extraordinary metabolic versatility?

B. xenovorans' exceptional metabolic capabilities, including PCB degradation, likely depend on specialized membrane compositions:

  • Metabolic integration: The membrane must support numerous transporters and enzymes involved in B. xenovorans' extensive aromatic compound metabolism pathways

  • Environmental adaptation: PlsY-derived phospholipids contribute to membrane properties that maintain function during exposure to hydrophobic pollutants

  • Compartmentalization: Different membrane compositions may create functional domains for specialized metabolic processes

  • Energy coupling: Proper membrane organization ensures efficient energy utilization across B. xenovorans' diverse metabolic network

Experimental approaches should include:

  • Lipidomic profiling under different growth conditions

  • Conditional plsY expression to correlate lipid composition with metabolic capabilities

  • Fluorescence microscopy to visualize membrane domains associated with specific metabolic processes

  • Membrane fluidity measurements during growth on different carbon sources including aromatic compounds

What approaches can distinguish between paralogs and functional redundancy in B. xenovorans lipid synthesis enzymes?

The significant paralogy in B. xenovorans (17.6% of proteins have better paralogs than orthologs in other genomes) presents challenges in studying plsY:

  • Experimental approaches:

    • Targeted gene knockouts with complementation testing

    • RNA interference to selectively reduce expression of individual paralogs

    • CRISPR interference for paralogue-specific transcriptional repression

    • Metabolic flux analysis using isotope-labeled precursors

  • Data analysis methods:

    • Transcriptome correlation networks to identify co-regulated genes

    • Protein-protein interaction mapping to determine functional complexes

    • Phylogenetic profiling across Burkholderia species

    • Expression quantitative trait loci (eQTL) analysis in natural isolates

The extensive redundancy observed in metabolic pathways (including formaldehyde oxidation and benzoate degradation) suggests potential backup systems may exist for plsY function as well.

How can researchers optimize heterologous expression systems for functional studies of B. xenovorans plsY?

Addressing challenges in functional expression requires:

  • Vector design considerations:

    • Promoter strength optimization (low-moderate expression often better for membrane proteins)

    • Signal sequence evaluation (native vs. host-optimized)

    • Fusion partner selection (GFP for folding assessment, MBP for solubility)

    • Affinity tag positioning (N- vs. C-terminal)

  • Host organism selection:

    • E. coli strains engineered for membrane protein expression

    • Pseudomonas species for closer phylogenetic relationship

    • Cell-free expression systems with supplied lipids

    • Baculovirus-insect cell system for complex proteins

  • Expression conditions:

    • Temperature reduction during induction (18-25°C)

    • Inducer concentration titration

    • Osmolyte addition (glycerol, betaine)

    • Membrane-fluidizing agents in severe cases

  • Functional validation methods:

    • In vivo complementation of conditional mutants

    • Liposome reconstitution with activity assays

    • Isothermal titration calorimetry for substrate binding

    • Native mass spectrometry for complex assembly

Optimizing these parameters is critical for obtaining functionally active enzyme for subsequent biochemical and structural studies.

How can B. xenovorans plsY be utilized for bioremediation applications?

Understanding plsY's role in membrane homeostasis offers several applications:

  • Engineered strains with modified plsY activity may show:

    • Enhanced tolerance to toxic compounds

    • Improved membrane integrity under stress conditions

    • Optimized growth in contaminated environments

    • Extended survival in field applications

  • Research-based approaches:

    • Identify membrane composition patterns that correlate with superior PCB degradation

    • Engineer plsY variants with altered substrate specificity for specialized membranes

    • Develop biosensors using plsY-regulated promoters to detect environmental conditions

    • Create synthetic microbial consortia with complementary lipid metabolic capabilities

The relationship between plsY function and the eleven "central aromatic" and twenty "peripheral aromatic" pathways in B. xenovorans suggests targeted modifications could enhance biodegradation performance.

What comparative genomic approaches reveal plsY evolution across Burkholderia species?

Systematic analysis strategies include:

  • Sequence-based analysis:

    • Multiple sequence alignment across Burkholderia species

    • Identification of conserved motifs versus variable regions

    • Selection pressure analysis (dN/dS ratios)

    • Correlation with genome size and niche specialization

  • Structural bioinformatics:

    • Homology modeling based on crystallized bacterial acyltransferases

    • Analysis of substrate binding pocket conservation

    • Molecular dynamics simulations of enzyme flexibility

    • Protein-protein interaction interface prediction

  • Genomic context analysis:

    • Gene neighborhood conservation analysis

    • Co-evolution patterns with other lipid metabolism enzymes

    • Correlation with replicon organization across species

    • Identification of potential regulatory elements

Given the high genomic plasticity within the Burkholderia genus, where conservation between B. xenovorans LB400 and B. cepacia complex strain 383 is only 44% , such comparative approaches can reveal adaptive patterns in phospholipid metabolism across diverse ecological niches.

How does plsY activity interface with B. xenovorans' carbon metabolism network?

The interface between phospholipid synthesis and carbon metabolism includes:

  • Integration with central carbon metabolism:

    • Glycerol-3-phosphate derives from glycolysis

    • Acyl chain precursors come from fatty acid synthesis

    • Carbon flux distribution between biomass and membrane synthesis

    • Energetic coupling with Calvin-Benson-Bassham cycle and formaldehyde oxidation pathways

  • Coordination with specialized metabolism:

    • Relationship to the eleven "central aromatic" pathways

    • Connections to twenty "peripheral aromatic" pathways

    • Integration with C1 metabolism (multiple formaldehyde oxidation pathways)

    • Potential links to nitrogen metabolism (nif genes, nap genes)

  • Experimental approaches:

    • 13C metabolic flux analysis

    • Metabolomics studies under varying carbon sources

    • Transcriptome analysis of plsY with carbon metabolism genes

    • Proteomics to identify potential protein-protein interactions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.