Recombinant Burkholderia xenovorans Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction

The Recombinant Burkholderia xenovorans Large-conductance Mechanosensitive Channel (MscL) is a bacterial protein channel that opens in response to mechanical forces in the lipid bilayer of a cell . MscL channels are found in microbial cells and function to prevent cell lysis during osmotic shock and stationary growth phases .

Burkholderia xenovorans LB400

Burkholderia xenovorans LB400 is a well-studied bacterium known for its ability to degrade polychlorinated biphenyls (PCBs) . LB400 has a large, multi-replicon genome of 9.73 Mbp, and it is the first nonpathogenic Burkholderia isolate to be sequenced . B. xenovorans LB400 exhibits high genomic plasticity, diversity, and specialization within the Burkholderia genus . It contains a high number of aromatic pathways, which contributes to its metabolic versatility .

3.1. Function and Mechanism

Mechanosensitive channels, such as MscL, are integral membrane proteins that respond to mechanical stimuli, like membrane stretch or changes in pressure . MscL channels open in response to stretch forces in the lipid bilayer . The channel protein forms a homopentamer, with each subunit containing two transmembrane regions . MscL channels gate via a bilayer mechanism evoked by hydrophobic mismatch and changes in membrane curvature and/or transbilayer pressure profile .

3.2. Structure

MscL and MscS (mechanosensitive channel of small conductance) have distinct polypeptide folds, indicating they do not share a common evolutionary ancestor, though they both have an N-terminal transmembrane domain and a C-terminal cytoplasmic domain . MscL contains two transmembrane (TM) helices . The permeation pathways of both MscL and MscS are roughly funnel-shaped, with a larger opening facing the periplasmic surface of the membrane and a narrower point near the cytoplasm .

3.3. Significance

MscL channels are upregulated during osmotic shock to prevent cell lysis . MscL has pharmacological potential in the creation of new antibiotics to combat multiple drug-resistant bacterial strains .

Recombinant MscL

Recombinant MscL refers to MscL that is produced using recombinant DNA technology.

Applications

ApplicationDescription
Antibiotic DevelopmentMscL's role in cell survival makes it a potential target for new antibiotics .
Mechanosensitivity ResearchRecombinant MscL can be used to study the mechanisms of mechanosensitivity .
Biotechnology and Enzyme-linked immunosorbent assay (ELISA)Recombinant Burkholderia xenovorans Large-conductance mechanosensitive channel (MscL) can be used for biotechnology solutions such as ELISA .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; Bxeno_A2116; Bxe_A2316; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-148
Protein Length
full length protein
Species
Paraburkholderia xenovorans (strain LB400)
Target Names
mscL
Target Protein Sequence
MSMVKEFKEFALKGNVMDLAVGVIIGGAFSTIVNSIVKDLIMPVVGLATGGLDFSNKFIR LGAIPPSFKGSPESYKDLQTAGVAVFGYGSFITVLINFLILAFIIFLMVKFINNLRKPAE AAPAEPPPTPEDVLLLREIRDSLKNSPR
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a regulatory role in cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of the mscL gene in Burkholderia xenovorans?

The mscL gene in B. xenovorans is part of the conserved genomic architecture found across Burkholderia species. Sequence data for B. xenovorans strain LB400 is available through genome databases (NZ_AAAJ00000000) . Phylogenetic analysis places B. xenovorans as distinct from but related to the Burkholderia cepacia complex (BCC), with clear separation shown in neighbor-joining trees constructed from concatenated nucleotide sequences . For researchers beginning work with this organism, accessing the complete genome through resources like the JGI database (http://genome.jgi-psf.org/finished_microbes/burfu/burfu.home.html) provides essential context for mscL studies .

How does the mscL protein from B. xenovorans compare structurally to other bacterial mechanosensitive channels?

While the search results don't provide specific structural details about B. xenovorans mscL, comparative genomic approaches similar to those used for multilocus sequence typing (MLST) can be applied to analyze conservation patterns. The MLST approach, which has successfully differentiated closely related Burkholderia species using seven conserved housekeeping genes, demonstrates that sequences from B. xenovorans can be effectively compared to those from other Burkholderia species . A similar methodology can be applied to study mscL conservation and structural variations.

What expression systems are most suitable for recombinant production of B. xenovorans mscL?

For optimal expression of recombinant B. xenovorans mscL, researchers should consider bacterial expression systems optimized for membrane proteins. Based on general Burkholderia research methodology, a nested PCR amplification approach similar to that used for MLST genes could be adapted for cloning the mscL gene . E. coli expression systems with appropriate membrane protein tags and inducible promoters typically yield the best results for mechanosensitive channel proteins. Codon optimization might be necessary, as Burkholderia species have different codon usage patterns compared to common laboratory strains.

What electrophysiological techniques are most effective for characterizing B. xenovorans mscL channel activity?

For precise characterization of B. xenovorans mscL channel activity, patch-clamp techniques in reconstituted liposome systems represent the gold standard. When designing such experiments, researchers should consider:

  • Lipid composition approximating the native B. xenovorans membrane environment

  • Patch-clamp configurations (cell-attached, inside-out, or outside-out) depending on the specific parameters being measured

  • Pressure application methods for channel activation

  • Single-channel versus whole-cell recording approaches

For detailed mechanistic studies, single-channel recordings provide the most valuable data on conductance, gating kinetics, and mechanosensitivity thresholds.

How can site-directed mutagenesis be optimized to investigate structure-function relationships in B. xenovorans mscL?

Site-directed mutagenesis studies of B. xenovorans mscL should focus on:

  • Conserved residues identified through comparative genomic analysis with other Burkholderia species

  • Transmembrane domains putatively involved in tension sensing

  • Pore-lining residues that influence conductance and ion selectivity

  • Cytoplasmic domains potentially involved in gating regulation

When designing mutagenesis studies, researchers should consider using approaches that account for the phylogenetic positioning of B. xenovorans relative to other Burkholderia species, as evidenced by the distinct clustering observed in neighbor-joining trees .

What are the challenges in differentiating native from recombinant mscL in functional studies using B. xenovorans?

When studying recombinant mscL in B. xenovorans backgrounds, researchers face several methodological challenges:

  • The potential for recombination events, which have been documented as important in the evolution of individual Burkholderia species

  • Need for precise strain identification using approaches similar to multilocus sequence typing (MLST) to ensure genetic background consistency

  • Requirement for knockout controls to eliminate native mscL expression

  • Development of specific antibodies or epitope tags that don't interfere with channel function

Researchers should consider using strains with confirmed sequence types (STs) for consistency across studies, following the precedent established by MLST approaches for Burkholderia species identification .

How can B. xenovorans mscL be utilized in biosensor development for mechanical stress detection?

For biosensor applications leveraging B. xenovorans mscL:

  • Consider fluorescent protein fusions to the C-terminus with appropriate linkers to maintain channel function

  • Design reconstituted systems using purified mscL in artificial liposomes with fluorescent indicators

  • Develop calcium-coupled reporting systems where mechanosensitive channel opening triggers calcium influx and downstream signaling events

  • Optimize immobilization strategies for the reconstituted channels on sensing platforms

When developing such applications, researchers should note that while B. xenovorans is phylogenetically distinct from pathogenic Burkholderia species (with 100% bootstrap values in phylogenetic analyses), biosafety considerations remain important .

What purification protocols yield the highest activity retention for recombinant B. xenovorans mscL?

Optimal purification of recombinant B. xenovorans mscL should include:

  • Detergent screening to identify the least disruptive extraction conditions

  • Affinity chromatography using histidine or other fusion tags placed at termini least likely to disrupt function

  • Size exclusion chromatography to ensure homogeneity and proper oligomeric assembly

  • Functional verification at each purification stage using liposome reconstitution and patch-clamp analysis

These approaches recognize the complexity of membrane protein purification while preserving native-like structure and function.

How does B. xenovorans mscL compare functionally to homologs from other Burkholderia species?

The functional comparison of B. xenovorans mscL with homologs from other Burkholderia species should consider:

  • Sequence conservation patterns, particularly in transmembrane and pore regions

  • Phylogenetic relationships established through multilocus sequence analysis (as done for species differentiation)

  • Differences in activation thresholds and conductance properties

  • Species-specific adaptation to environmental pressures

Phylogenetic analyses have established that B. xenovorans is distinctly separated from the Burkholderia cepacia complex (BCC) with high bootstrap values , suggesting potential functional differences in their respective mechanosensitive channels.

What evidence exists for horizontal gene transfer affecting mscL evolution in Burkholderia species?

Examination of horizontal gene transfer in the context of mscL evolution should consider:

  • Recombination analysis methods similar to those used to calculate the Index of Association (Ia) for Burkholderia species

  • Nucleotide sequence analysis across different Burkholderia species to identify anomalous conservation patterns

  • Comparison of gene trees versus species trees to identify incongruence

  • Analysis of flanking regions for mobile genetic elements

There is evidence for recombination playing an important role in the evolution of individual Burkholderia species, with B. vietnamiensis showing the greatest evidence of recombination (Ia value of -0.067) . Similar molecular evolutionary approaches could be applied specifically to mscL genes.

How has the mscL channel evolved in response to the diverse ecological niches occupied by Burkholderia species?

The genus Burkholderia comprises more than 90 species living in diverse ecological niches including water, soil, plant rhizosphere, and in association with fungi, insects, and animals . Analysis of mscL evolution should examine:

  • Sequence variation patterns in relation to habitat adaptation

  • Selection pressure analysis on specific functional domains

  • Correlation between channel properties and environmental stressors

  • Comparison between environmental and clinical isolates within the same species

Notably, MLST analysis of Burkholderia species found no differentiation between strains recovered from environmental or clinical sources , suggesting that core genes may be conserved across different ecological adaptations.

What are the main pitfalls in heterologous expression of B. xenovorans mscL, and how can they be addressed?

Common challenges in heterologous expression include:

  • Inclusion body formation - addressable through lower induction temperatures, specialized host strains, and fusion partners

  • Protein misfolding - mitigated by addition of chaperones or expression in specialized membrane protein production strains

  • Toxicity to host cells - controlled by tight expression regulation and use of leakiness-resistant promoters

  • Low yield - improved through codon optimization and culture condition refinement

For complex membrane proteins like mscL, a nested PCR amplification approach with carefully designed primers (similar to that used for MLST genes in Burkholderia) may help overcome amplification difficulties .

How can researchers distinguish between direct and indirect effects when studying compounds that modulate B. xenovorans mscL activity?

To distinguish direct from indirect modulatory effects:

  • Implement liposome reconstitution systems with purified protein to eliminate cellular factors

  • Use patch-clamp electrophysiology on isolated membrane patches to verify direct interactions

  • Develop competition assays with known modulators to identify binding site overlap

  • Perform mutagenesis of putative interaction sites to confirm molecular targets

These approaches help establish causality in observed effects and eliminate confounding factors from cellular contexts.

How is mscL expression regulated in B. xenovorans in response to environmental signals?

Investigation of mscL regulation should consider:

  • Promoter analysis with reporter fusions to identify regulatory elements

  • Examination of potential quorum sensing involvement, as Burkholderia species employ sophisticated cell-to-cell communication systems

  • Analysis of the role of transcriptional regulators similar to LepR, which has been identified in B. cenocepacia as controlling expression of other important cellular components

  • Evaluation of post-transcriptional regulation through 5' untranslated leader regions, which have been shown to be important in regulation of other genes in Burkholderia

The potential involvement of fatty acid-based signaling systems like cis-2-dodecenoic acid (BDSF), which has been shown to be widespread in Burkholderia species, should be investigated in relation to mscL regulation .

What role does B. xenovorans mscL play in adaptation to hypoosmotic stress compared to other osmoregulatory systems?

Analysis of mscL's contribution to osmotic stress responses should:

  • Investigate the phenotypic consequences of mscL knockout in various osmotic challenge conditions

  • Compare the timing and magnitude of mscL activation relative to other osmolarity-responsive systems

  • Evaluate potential interactions with other membrane tension sensors

  • Examine species-specific adaptations in B. xenovorans compared to other Burkholderia species

This research question acknowledges that mscL likely works in concert with other osmoregulatory systems as part of a coordinated stress response network.

What emerging technologies show promise for high-resolution structural studies of B. xenovorans mscL?

Promising structural biology approaches include:

TechnologyAdvantagesLimitationsResolution Range
Cryo-electron microscopyNative-like conditions, no crystallization requiredSample preparation challenges2-4 Å
X-ray crystallographyHighest possible resolutionDifficult for membrane proteins1.5-3 Å
NMR spectroscopyDynamic information, solution stateSize limitations3-5 Å
Molecular dynamics simulationsMechanistic insights, conformational statesComputational intensityModel-dependent

These approaches could build upon the comparative genomics frameworks established for Burkholderia species analysis to link structure with function.

How might synthetic biology approaches enable novel applications of engineered B. xenovorans mscL variants?

Synthetic biology applications could include:

  • Engineering modified channel sensitivity thresholds for biosensing applications

  • Creating chimeric channels with novel gating properties

  • Developing controlled cellular release systems for biotechnology applications

  • Designing selective filters for specific molecular transport

Such applications would require precise genetic manipulation approaches, potentially building on the molecular typing methodologies developed for Burkholderia species identification .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.