Recombinant Burkholderia xenovorans Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

MsbA is an ATP-binding cassette (ABC) transporter responsible for flipping lipid A—a key component of lipopolysaccharide (LPS)—from the cytoplasmic to the periplasmic leaflet of the inner membrane in Gram-negative bacteria . In Burkholderia xenovorans, recombinant MsbA retains this function and is expressed with a His tag for purification . Its activity is vital for bacterial viability, as lipid A is a prerequisite for outer membrane assembly and pathogenicity .

Sequence and Physical Properties

PropertyValue/Description
UniProt IDQ142P6
Amino Acid Sequence597 residues, full-length (1-597aa)
Molecular Weight~67 kDa (calculated)
Expression HostEscherichia coli with N-terminal His tag
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer (6% trehalose, pH 8.0) at -20°C/-80°C

Substrate Binding and Transport

  • MsbA binds lipid A with high affinity (KdK_d in µM range) and transports it via a "trap-and-flip" mechanism .

  • Conformational changes in MsbA widen the transmembrane portal to accommodate lipid A, as observed in X-ray structures (2.8 Å resolution) .

  • Simultaneous binding of lipid A and amphipathic drugs (e.g., daunorubicin) occurs at distinct sites, suggesting substrate promiscuity .

ATPase Activity

  • ATP hydrolysis drives the transition from inward- to outward-facing conformations .

  • Fluorescence quenching studies show nucleotide binding reduces lipid A affinity, indicating bidirectional communication between NBDs and TMDs .

Applications in Antimicrobial Research

MsbA is a validated drug target due to its essential role in LPS biogenesis. Key findings include:

  • Inhibitors targeting MsbA’s ATPase activity disrupt lipid A transport, compromising bacterial membrane integrity .

  • Structural studies reveal druggable pockets in the transmembrane cavity and periplasmic cleft .

Recombinant Expression and Purification

The recombinant protein is expressed in E. coli and purified using affinity chromatography. Key steps involve:

  • Tagging: N-terminal His tag for Ni-NTA column purification .

  • Stability: Requires glycerol (5–50%) for long-term storage .

  • Activity: Retains ATPase function post-purification, confirming structural integrity .

Comparative Analysis with Orthologs

FeatureB. xenovorans MsbA B. pseudomallei MsbA B. mallei MsbA
UniProt IDQ142P6Q63VX7Q62IG3
Sequence Identity100%89%88%
Expression HostE. coliE. coliE. coli
Key Functional ResiduesCys315 (MIANS labeling) Cys315 (homologous) Cys315 (homologous)

Research Challenges and Future Directions

  • Structural Dynamics: High-resolution cryo-EM studies are needed to capture intermediate conformations during lipid A transport .

  • Drug Development: Screening for MsbA-specific inhibitors could yield novel antibiotics against Burkholderia pathogens .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please specify this in your order; we will prioritize fulfilling your request.
Synonyms
msbA; Bxeno_A1155; Bxe_A3290; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-597
Protein Length
full length protein
Species
Paraburkholderia xenovorans (strain LB400)
Target Names
msbA
Target Protein Sequence
MSAKPTLSKPIGSGEASSPAVVFRRLWPYIKPLIWVLIGAIVAMAVSAATDAAIPALLKP LLDKGFGAHANDRAKWFVPAAVIGLALIRSLSQYASGYLLAYVTNKILLDLRLKMFDRMI HTSVAFFQRETASTVINAIVFEVNQILNVLLSVLVTLVRDSLTVVFLLGYLFYLNWRLTL IVAVLLPAIGWLVGKINRRLRRLNREHQLLTNELSYIVEESVGGYKVVKVHNGEQYEMDR FESMSKRLRGYAMRMTVSGGLAQPLTQFLASIALAVVITIAVVQSSSDQTTVGGFVAFVT SMLLIISPLKHLMDVNQPLQRGMTACEMIFGLIDEPSEPEGGGKPLERAHGAVEFRDVSF VYSGNATHNRHTLDQISFRVAPGEMIALAGPSGSGKTTLVNLLPRFFDPTGGQILVDGVA IPEYDLHALRSQIAMVSQDVVLFNDTVANNVAYGQTADAGKVKAALRAANLWDTVEAMPK GIETLVGDNGMMLSGGQRQRLAIARAIYKDAPILILDEATSALDSESERHVQAALETLMK GRTTLVIAHRLSTIERADRILVMEAGRIVESGSHRELLAQDGLYAHLHRIQFQQSAA
Uniprot No.

Target Background

Function

This recombinant Burkholderia xenovorans Lipid A export ATP-binding/permease protein MsbA (msbA) is involved in lipopolysaccharide (LPS) biosynthesis. It facilitates the translocation of lipid A-core from the inner to the outer leaflet of the inner membrane. The protein's transmembrane domains (TMDs) form a pore in the inner membrane, while the ATP-binding domain (NBD) provides the necessary energy for this process.

Database Links
Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of the msbA gene in Burkholderia xenovorans LB400?

The msbA gene in Burkholderia xenovorans LB400 is located on chromosome 1 of its multi-replicon genome. B. xenovorans LB400 possesses one of the largest known bacterial genomes at 9.73-Mbp, distributed across three replicons: chromosome 1 (4.9 Mbp), chromosome 2 (3.36 Mbp), and a megaplasmid (1.42 Mbp) . The msbA gene is specifically identified as Bxeno_A1155 or Bxe_A3290 in ordered locus names . The gene's placement on chromosome 1 rather than the smaller replicons is significant as this largest replicon typically experiences more stringent selective pressure and houses genes considered essential for core cellular functions .

What are the structural characteristics of the MsbA protein in B. xenovorans?

The MsbA protein in B. xenovorans LB400 is a full-length protein of 597 amino acids characterized as a Lipid A export ATP-binding/permease protein with the Enzyme Commission number EC= 3.6.3.- . The protein functions as an ATP-dependent lipid A-core flippase that facilitates the transport of Lipid A across bacterial membranes. Its amino acid sequence reveals several critical domains:

  • Transmembrane domains that anchor the protein in the bacterial membrane

  • ATP-binding cassette (ABC) transporter signature motifs

  • A nucleotide-binding domain (NBD) characterized by Walker A and Walker B motifs

  • A substrate-binding domain

The protein belongs to the ABC transporter superfamily, which requires ATP hydrolysis to actively transport substrates across membranes .

What are the optimal storage conditions for recombinant B. xenovorans MsbA protein to maintain structural and functional integrity?

For optimal preservation of recombinant B. xenovorans MsbA, researchers should:

  • Store the lyophilized protein at -20°C for short-term storage or -80°C for extended storage periods.

  • After reconstitution, prepare working aliquots to avoid repeated freeze-thaw cycles, which significantly degrade protein quality.

  • Maintain working aliquots at 4°C for no longer than one week.

  • Reconstitute in appropriate Tris-based buffer with 50% glycerol optimized for this specific protein.

  • For long-term storage of reconstituted protein, add glycerol to a final concentration of 5-50% and store in single-use aliquots at -20°C/-80°C .

The presence of glycerol in the storage buffer is particularly important for membrane proteins like MsbA as it helps maintain the native conformation by preventing denaturation during freeze-thaw cycles.

How can researchers effectively express and purify recombinant B. xenovorans MsbA for functional studies?

The expression and purification of functional recombinant B. xenovorans MsbA requires a methodical approach:

Expression System Selection:
E. coli is typically the preferred heterologous expression system for MsbA proteins, as demonstrated in similar studies with MsbA from other bacterial species .

Expression Protocol:

  • Clone the full-length msbA gene (1-597aa) from B. xenovorans LB400 into an expression vector with an N-terminal His-tag.

  • Transform into an E. coli expression strain optimized for membrane proteins (e.g., C41(DE3) or C43(DE3)).

  • Grow cultures at reduced temperatures (16-25°C) after induction to promote proper folding.

  • Include specific membrane protein-friendly detergents during cell lysis and purification steps.

Purification Strategy:

  • Solubilize membrane fraction using mild detergents (typically n-dodecyl-β-D-maltoside or LDAO).

  • Purify using nickel affinity chromatography targeting the His-tag.

  • Further purify using size exclusion chromatography to isolate properly folded protein.

  • Validate protein purity using SDS-PAGE (target >90% purity).

  • Verify protein functionality through ATPase activity assays .

How does the ABC transporter activity of B. xenovorans MsbA compare to homologous proteins in other Burkholderia species?

The ABC transporter activity of B. xenovorans MsbA must be examined in context of the extensive genomic plasticity observed within the Burkholderia genus. Comparative analysis reveals:

Evolutionary Conservation:
Only approximately 44% of genes are conserved between B. xenovorans LB400 and Burkholderia cepacia complex strain 383, indicating significant divergence that may extend to MsbA functional properties .

Functional Adaptations:
The high genomic plasticity within Burkholderia (with B. xenovorans genome sizes varying from 7.4 to 9.73 Mbp among strains) suggests potential functional specialization of MsbA to accommodate different ecological niches .

Paralog Distribution:
Research indicates that 17.6% of B. xenovorans LB400 proteins have better paralogs within the same genome than orthologs in different genomes. This high rate of gene duplication and divergence potentially affects MsbA function through:

  • Substrate specificity alterations

  • Regulatory pathway differences

  • Differential expression patterns under varied environmental conditions

Researchers comparing MsbA activity across Burkholderia species should employ standardized ATPase assays with consistent substrate panels and consider the genomic context when interpreting functional differences.

What role might B. xenovorans MsbA play in the organism's remarkable capacity for aromatic compound degradation?

B. xenovorans LB400 contains an exceptionally high number of aromatic degradation pathways (eleven "central aromatic" and twenty "peripheral aromatic" pathways), making it one of the most metabolically versatile bacteria for degrading aromatic compounds, including polychlorinated biphenyls (PCBs) .

The MsbA protein may contribute to this capability through:

Membrane Lipid Homeostasis:

  • MsbA maintains outer membrane integrity during exposure to toxic aromatic compounds

  • Facilitates adaptation to hydrophobic substrates by modulating membrane fluidity

Potential Export Functions:

  • May participate in efflux of aromatic degradation intermediates

  • Could contribute to cellular detoxification mechanisms when processing aromatic compounds

Integration with Metabolic Networks:

  • Potentially coordinates with the extensive network of transporters (over 23 aromatic acid transporters) identified in B. xenovorans

  • May function in conjunction with the many major facilitator superfamily transporters present in the organism

Experimental approaches to verify these roles could include:

  • Knockout studies examining aromatic compound tolerance

  • Membrane composition analysis under various growth conditions

  • Metabolomic profiling comparing wild-type and MsbA-modified strains during aromatic compound metabolism

What methods can be used to assess the functional activity of recombinant B. xenovorans MsbA protein?

Multiple complementary approaches can be employed to comprehensively evaluate the functional activity of recombinant B. xenovorans MsbA:

ATP Hydrolysis Assays:

  • Colorimetric phosphate release assays (malachite green method)

  • Coupled enzyme assays (pyruvate kinase/lactate dehydrogenase system)

  • Radioactive [γ-32P]ATP hydrolysis measurements

Lipid A Transport Assays:

  • Reconstitution in proteoliposomes with fluorescently labeled Lipid A analogs

  • Inside-out membrane vesicle transport studies

  • FRET-based assays for monitoring substrate translocation

Structural Dynamics Assessment:

  • Limited proteolysis to identify conformational changes upon nucleotide binding

  • Intrinsic tryptophan fluorescence spectroscopy

  • Circular dichroism (CD) spectroscopy for secondary structure analysis

Table 1: Representative ATPase Activity Protocol for MsbA Proteins

StepParameterCondition
1. Reaction BufferComposition50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 5 mM MgCl₂, 10% glycerol, 0.05% DDM
2. Protein ConcentrationRange0.1-1.0 μg/reaction
3. ATP ConcentrationRange0-5 mM (for Km determination)
4. IncubationTime/Temperature30 minutes at 37°C
5. DetectionMethodMalachite green phosphate detection (A620)
6. Data AnalysisParametersVmax, Km, and catalytic efficiency (kcat/Km)

How can researchers differentiate between the roles of B. xenovorans MsbA and potential functional paralogs?

Differentiating the roles of B. xenovorans MsbA from potential functional paralogs requires a multi-faceted approach:

Computational Analysis:

  • Phylogenetic tree construction to identify true paralogs

  • Protein domain architecture comparison

  • Structural modeling to predict functional differences

  • Promoter analysis to identify differential regulation patterns

Experimental Approaches:

  • Genetic Manipulation:

    • Individual and combinatorial gene knockout/knockdown studies

    • Complementation assays with paralogous genes

    • Promoter-reporter fusion constructs to monitor expression patterns

  • Biochemical Characterization:

    • Side-by-side substrate specificity profiles

    • Inhibitor sensitivity comparisons

    • Lipid environment requirements

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation to identify differential binding partners

    • Bacterial two-hybrid screens

    • Cross-linking mass spectrometry

The high rate of gene duplication and divergence in B. xenovorans (17.6% of proteins having better paralogs within the same genome) makes this differentiation particularly important . Researchers should leverage the genomic context information to predict functional differences that can then be experimentally verified.

What are the major challenges in working with recombinant B. xenovorans MsbA protein and how can they be addressed?

Challenge 1: Membrane Protein Solubilization and Stability

  • Solution: Systematically screen detergents (DDM, LDAO, LMNG) at various concentrations to identify optimal solubilization conditions. Add cholesteryl hemisuccinate (CHS) at 0.01-0.05% to stabilize the protein. Consider nanodiscs or styrene-maleic acid lipid particles (SMALPs) for detergent-free extraction.

Challenge 2: Low Expression Yields

  • Solution: Optimize codon usage for expression host, use specialized strains (C41/C43), lower induction temperature (16-20°C), and extend expression time (24-48 hours). Consider fusion partners (MBP, SUMO) to enhance solubility and expression.

Challenge 3: Proper Folding Verification

  • Solution: Implement thermal shift assays to assess protein stability. Compare ATPase activity with well-characterized MsbA homologs. Use limited proteolysis to verify native conformation.

Challenge 4: Functional Reconstitution

  • Solution: Select lipid compositions that mimic B. xenovorans membrane environment. Test different protein:lipid ratios (1:50 to 1:500) and reconstitution methods (detergent removal by dialysis, Bio-Beads, or cyclodextrin).

Table 2: Troubleshooting Guide for Common MsbA Experimental Issues

ProblemPossible CauseSolution
Low ATPase activityDetergent inhibitionChange detergent type or reduce concentration
Improper foldingOptimize purification conditions, avoid aggregation
Lipid environmentAdd specific lipids (E. coli polar extract) to assay
Aggregation during purificationConcentration too highMaintain below 5 mg/mL during concentration steps
Buffer incompatibilityAdd glycerol (10%) and ensure adequate detergent
Temperature effectsPerform all steps at 4°C
Poor stabilityOxidationAdd reducing agent (1-5 mM DTT or TCEP)
Protease contaminationInclude protease inhibitors throughout purification
Detergent lossMaintain detergent above CMC in all buffers

How should researchers approach experimental design when studying the functional role of B. xenovorans MsbA in Lipid A transport?

Step 1: Establish Baseline Characterization

  • Determine basal ATPase activity parameters (Km, Vmax)

  • Assess nucleotide binding affinities using fluorescence spectroscopy

  • Characterize pH and temperature optima relevant to B. xenovorans physiology

Step 2: Design Appropriate Controls

  • Include well-characterized MsbA proteins from model organisms (E. coli, Salmonella)

  • Generate catalytically inactive mutants (Walker A lysine substitution)

  • Prepare control proteoliposomes without protein

Step 3: Implement Multi-Parameter Approaches

  • Correlate ATP hydrolysis with substrate transport

  • Use fluorescence-based real-time assays for transport kinetics

  • Combine biochemical data with in vivo phenotypic analysis

Step 4: Consider Ecological Context

  • Test function under conditions mimicking B. xenovorans natural environment:

    • Temperature ranges (10-30°C)

    • pH variations (5.5-8.0)

    • Presence of aromatic compounds metabolized by B. xenovorans

Step 5: Analyze Structure-Function Relationships

  • Generate targeted mutations based on sequence alignment with characterized homologs

  • Focus on residues in the predicted substrate-binding pocket

  • Examine conserved motifs specific to Burkholderia species

Internal Validity Considerations:
The experimental design must demonstrate convincingly that changes in transport activity are a function of the specific intervention and not the result of uncontrolled factors . This requires:

  • Appropriate controls for each experiment

  • Replication to confirm reproducibility

  • Systematic variation of single parameters

  • Statistical analysis to determine significance

How might B. xenovorans MsbA research contribute to our understanding of bacterial adaptation to environmental pollutants?

B. xenovorans LB400 is recognized for its exceptional ability to degrade polychlorinated biphenyls (PCBs) and other environmental pollutants . Future research into its MsbA protein could provide critical insights into bacterial adaptation mechanisms through several avenues:

Membrane Remodeling Mechanisms:

  • Investigate how MsbA activity changes during exposure to aromatic pollutants

  • Determine if MsbA facilitates membrane composition alterations that enhance pollutant tolerance

  • Explore potential correlations between MsbA expression/activity and the activation of aromatic degradation pathways

Comparative Genomics Applications:

  • Compare MsbA structure and function across Burkholderia strains with varying pollutant degradation capabilities

  • Identify evolutionary adaptations in MsbA that correlate with expanded metabolic capacity

  • Analyze whether lateral gene transfer events affecting MsbA contribute to enhanced environmental adaptation

Biotechnological Implications:

  • Assess whether MsbA modification could enhance bioremediation capabilities

  • Determine if MsbA engineering could improve whole-cell biocatalysts for environmental applications

  • Explore MsbA as a potential target for enhancing bacterial survival in contaminated environments

What unexplored aspects of B. xenovorans MsbA function merit further investigation?

Despite current knowledge, several critical aspects of B. xenovorans MsbA function remain unexplored:

Regulatory Network Integration:

  • How is MsbA expression regulated in response to environmental stressors?

  • Does MsbA activity coordinate with the extensive aromatic degradation pathways?

  • Is there cross-talk between MsbA and the transcriptional regulators like RcoM(Bx)-1 ?

Substrate Specificity:

  • Beyond Lipid A, what other substrates might B. xenovorans MsbA transport?

  • Does substrate specificity differ from MsbA proteins in pathogenic Burkholderia species?

  • Could MsbA participate in export of secondary metabolites or signaling molecules?

Ecological Context:

  • How does MsbA function contribute to B. xenovorans' survival in its soil and rhizosphere niche?

  • Is MsbA activity involved in plant-microbe interactions?

  • Does MsbA play a role in biofilm formation in environmental contexts?

Structural Adaptations:

  • What structural features distinguish B. xenovorans MsbA from homologs in other species?

  • How do these structural differences relate to B. xenovorans' environmental adaptability?

  • Could unique structural elements be exploited for selective inhibition or enhancement?

Addressing these questions will require integrative approaches combining structural biology, molecular genetics, biochemistry, and ecological studies to fully elucidate the multifaceted roles of this important membrane transporter.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.