Recombinant Burkholderia xenovorans Membrane protein insertase YidC (yidC)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference in the order remarks and we will fulfill your request.
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference in the order remarks and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery estimates, please contact your local distributor.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice packaging is required, please notify us in advance for an additional fee.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice packaging is required, please notify us in advance for an additional fee.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
To ensure proper reconstitution, centrifuge the vial briefly before opening to collect the contents at the bottom. We recommend dissolving the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our default final concentration of glycerol is 50% and can serve as a reference for your preparations.
Shelf Life
The shelf life of our proteins is influenced by several factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same temperature conditions.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same temperature conditions.
Storage Condition
Upon receipt, store the protein at -20°C/-80°C. Aliquoting is recommended for multiple uses. To avoid degradation, minimize repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag preference, please communicate it to us and we will prioritize its implementation.
Synonyms
yidC; Bxeno_A4427; Bxe_A4466; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-552
Protein Length
full length protein
Species
Paraburkholderia xenovorans (strain LB400)
Target Names
yidC
Target Protein Sequence
MDIKRTVLWVIFFMSAVMLFDNWQRDHGRPSMFFPSATPTRTVGSAAPGTTTPGTQPADL
PATNAAAPGNAPAATQSQLIKFNTDVYSGEIDTRGGTLSKLSLVKQGDGKQPDLVITLFD
RTANHTYLARTGLLGGDFPNHNDIYTPLPNQPHDLTGDEKSFQISFESPVKGGVKVIKTY
TFTRGSYVIGVDTKIQNVGTTPVSPSVYMELVRDDQPVETPRFSHTFIGPAVYTDQHHFQ
KMTFGDIDKNKQDYATSADNGWIAMVQHYFASAWIPQQGAKRDIYVEKIDPALYRVGVKE
PVPTIAPGQTVDVSARLFAGPEEERMLEGIAPGLELVKDYGWVTIIAKPLFWLLEKIHSY
VGNWGWSIVLLTLLIKAVFFPLSAASYKSMARMKAITPRMQALRERFKGDPQKMNSALME
LYKTEKVNPFGGCLPVVIQIPVFISLYWVLLSSVEMRGAPWILWIHDLSQQDPFFILPVL
MAVSMFLQTKLNPTPPDPVQAKMMMFMPIAFSVMFFFFPAGLVLYYVVNNVLSIAQQYYI
TRMMGQAKTKAA
Uniprot No.
Target Background
Function
YidC, the membrane protein insertase, is essential for the insertion and proper folding of integral membrane proteins into the membrane. It plays a crucial role in the integration of both Sec-dependent and Sec-independent membrane proteins, as well as in the insertion of certain lipoproteins. YidC also assists in the folding of multispanning membrane proteins.
Database Links
KEGG: bxb:DR64_2137
STRING: 266265.Bxe_A4466
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
