Recombinant Burkholderia xenovorans NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. To ensure a specific tag type, please inform us in advance, and we will prioritize its implementation.
Synonyms
nuoA; Bxeno_A1228; Bxe_A3214; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Paraburkholderia xenovorans (strain LB400)
Target Names
nuoA
Target Protein Sequence
MNLAAYFPVLLFLIVGTGLGVALVSIGKILGPNKPDTEKNAPYECGFEAFEDARMKFDVR YYLVAILFIIFDLETAFLFPWGVALRDIGWPGFMAMMIFLLEFLLGFAYIWKKGGLDWE
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this organism, ubiquinone is the presumed immediate electron acceptor. This redox reaction is coupled with proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thereby conserving energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the NADH-quinone oxidoreductase complex in Burkholderia xenovorans?

The NADH-quinone oxidoreductase complex, also known as Complex I or NADH dehydrogenase I, is a multi-subunit enzyme involved in the respiratory chain. In B. xenovorans, this complex catalyzes the transfer of electrons from NADH to quinone coupled with proton translocation across the membrane. The nuoA subunit is one of several components making up this complex. The enzyme is classified with EC number 1.6.99.5 and is essential for energy metabolism in this bacterium .

What is known about the nuoA gene structure in B. xenovorans?

The nuoA gene (also annotated as Bxeno_A1228 or Bxe_A3214) in Paraburkholderia xenovorans strain LB400 encodes the NADH-quinone oxidoreductase subunit A. The complete amino acid sequence consists of 119 amino acids. The nuoA gene is part of the larger nuo operon, which encodes multiple subunits of the NADH-quinone oxidoreductase complex .

How does B. xenovorans nuoA compare to homologous proteins in other species?

FeatureB. xenovorans nuoAE. coli nuoA
Length119 amino acids147 amino acids
Membrane spansSimilar membrane-spanning domains3 transmembrane helices
UniProt IDQ142H3Q0TFF8
Sequence identityReferenceApproximately 30-40% identity

The differences likely reflect adaptations to specific metabolic requirements of each organism .

What role does oxidative stress play in relation to NADH-quinone oxidoreductase in B. xenovorans?

B. xenovorans possesses robust oxidative stress response mechanisms that are interconnected with electron transport complexes like NADH-quinone oxidoreductase. When exposed to oxidizing agents like paraquat or H₂O₂, the bacterium activates defense systems regulated by OxyR and SoxR transcriptional regulators. The NADH-quinone oxidoreductase complex can be a source of reactive oxygen species (ROS) during normal functioning, but also plays a role in managing cellular redox balance. The oxidative stress response is particularly important given B. xenovorans' role in degrading aromatic compounds, which can generate additional oxidative stress .

What are the optimal expression conditions for producing recombinant B. xenovorans nuoA protein?

The expression of recombinant B. xenovorans nuoA requires careful optimization of several parameters:

Expression System Selection:

  • E. coli is typically used for initial expression trials due to its high yield and ease of manipulation

  • Yeast expression systems may provide better folding for membrane proteins like nuoA

Expression Protocol:

  • Clone the nuoA gene (Bxeno_A1228) into an appropriate expression vector with a His-tag or other purification tag

  • Transform into the expression host

  • Induce expression at lower temperatures (16-25°C) to improve folding

  • For membrane proteins like nuoA, include membrane-stabilizing agents in the growth medium

Purification Strategy:

  • Extract using mild detergents to preserve native conformation

  • Purify using affinity chromatography based on the incorporated tag

  • Consider reconstitution into nanodiscs or liposomes for functional studies

Storage Considerations:

  • Store at -20°C/-80°C with 50% glycerol

  • Avoid repeated freeze-thaw cycles

  • For short-term use, store working aliquots at 4°C for up to one week

How can researchers verify the functionality of recombinant nuoA in experimental settings?

Multiple complementary approaches can be used to assess nuoA functionality:

Enzymatic Activity Assays:

  • NADH oxidation assay - Measure the decrease in absorbance at 340 nm

  • Electron transfer assays using artificial electron acceptors

  • Proton translocation measurements in reconstituted systems

Structural Integrity Assessment:

  • Circular dichroism spectroscopy to verify secondary structure

  • Limited proteolysis to confirm proper folding

  • Size-exclusion chromatography to confirm complex assembly

Complementation Studies:

  • Express recombinant nuoA in nuoA-deficient strains

  • Assess restoration of NADH dehydrogenase activity

  • Evaluate growth under conditions requiring functional NADH-quinone oxidoreductase

This multi-faceted approach provides comprehensive validation of protein functionality .

What is the relationship between nuoA and the oxidative stress response in B. xenovorans during aromatic compound degradation?

The relationship between nuoA and oxidative stress during aromatic degradation involves complex regulatory mechanisms:

Experimental Evidence:
Studies have shown that exposure to oxidizing agents like paraquat induces expression of oxidative stress response genes in B. xenovorans including oxyR, fumC, ahpC1, sodB1, and ohrB. Proteome analysis revealed induction of antioxidant proteins AhpCF and DpsA, the universal stress protein UspA, and the RNA chaperone CspA .

Interconnected Pathways:
The electron transport chain (including NADH-quinone oxidoreductase) and aromatic degradation pathways are metabolically linked, with electrons from aromatic degradation potentially feeding into the respiratory chain. This creates a feedback loop where proper functioning of nuoA and other complex I components helps maintain redox balance during aromatic metabolism .

What structural features of nuoA contribute to its role in the NADH-quinone oxidoreductase complex?

The nuoA subunit has several key structural features that determine its function:

Membrane Topology:
The protein contains multiple transmembrane domains that anchor it in the bacterial membrane. These hydrophobic regions are critical for proper assembly of the entire complex.

Key Functional Domains:

  • N-terminal region: Contains hydrophilic segments involved in interaction with other subunits

  • Transmembrane helices: Form part of the proton channel through the complex

  • Conserved residues: Specific amino acids critical for proton translocation

Complex Assembly Interface:
NuoA interacts directly with several other subunits in the NADH-quinone oxidoreductase complex, particularly nuoH and nuoJ, forming part of the membrane domain of the complex .

What are the best approaches for studying the integration of nuoA into the NADH-quinone oxidoreductase complex?

Studying nuoA integration requires specialized techniques for membrane protein analysis:

Biochemical Approaches:

  • Blue native PAGE to visualize intact complexes

  • Cross-linking studies to identify interaction partners

  • Sucrose gradient ultracentrifugation for complex isolation

  • Pull-down assays with tagged nuoA to identify interacting subunits

Structural Biology Methods:

  • Cryo-electron microscopy of purified complexes

  • X-ray crystallography (challenging but has been successful for bacterial complex I)

  • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

Genetic Approaches:

  • Complementation studies with chimeric proteins

  • Systematic mutagenesis of interaction interfaces

  • Suppressor mutation analysis to identify functional relationships between subunits

How can researchers overcome challenges in expression and purification of membrane-bound nuoA protein?

Membrane proteins like nuoA present specific challenges in expression and purification:

Expression Optimization:

  • Use specialized E. coli strains designed for membrane protein expression (C41, C43)

  • Consider cell-free expression systems for difficult targets

  • Optimize induction conditions (temperature, inducer concentration, time)

  • Test fusion partners that enhance membrane protein folding and stability

Solubilization Strategies:

  • Screen multiple detergents (DDM, LMNG, digitonin) for optimal extraction

  • Consider use of styrene-maleic acid copolymers (SMALPs) to extract native lipid environment

  • Test nanodiscs or amphipols for maintaining stability after purification

Purification Enhancements:

  • Implement two-step purification protocols (affinity chromatography followed by size exclusion)

  • Include stabilizing additives throughout purification (glycerol, specific lipids)

  • Monitor protein quality by fluorescence-detection size-exclusion chromatography

Storage Optimization:

  • Determine optimal detergent concentration for long-term stability

  • Test addition of specific lipids that enhance stability

  • Evaluate protein stability in different buffer compositions

What techniques are most effective for analyzing the role of nuoA in oxidative stress response?

Multiple complementary approaches can elucidate nuoA's role in oxidative stress:

Gene Expression Analysis:

  • qRT-PCR to measure nuoA expression under oxidative stress conditions

  • RNA-seq to identify co-regulated genes in the oxidative stress response

  • Chromatin immunoprecipitation to identify transcription factor binding sites near nuoA

Protein-Level Analysis:

  • Western blotting to quantify nuoA protein levels during stress

  • LC-MS/MS proteomics to identify post-translational modifications induced by stress

  • Protein-protein interaction studies under normal and stress conditions

Physiological Approaches:

  • Growth curve analysis of wild-type vs. nuoA mutant strains under oxidative stress

  • ROS measurement using fluorescent probes in different genetic backgrounds

  • Oxygen consumption measurements to assess respiratory chain function

Genetic Approaches:

  • Construction of nuoA deletion or point mutation strains

  • Complementation with wild-type or mutant nuoA

  • Double mutant analysis with oxidative stress response genes

What bioinformatic tools and resources are most valuable for studying B. xenovorans nuoA?

Several specialized tools and resources can facilitate nuoA research:

Sequence Analysis Tools:

  • TMHMM/HMMTOP for transmembrane domain prediction

  • ConSurf for evolutionary conservation mapping

  • PSIPRED for secondary structure prediction

  • Phyre2 for structural modeling based on homology

Genomic Resources:

  • The complete genome sequence of B. xenovorans LB400 (9.73-Mbp)

  • Comparative genomic tools to analyze nuoA across Burkholderia species

  • Regulatory network databases to identify potential regulators of nuoA

Specialized Databases:

  • UniProt entry Q142H3 for curated information on nuoA

  • BRENDA enzyme database for NADH-quinone oxidoreductase (EC 1.6.99.5)

  • Protein Data Bank for structural information on homologous complex I components

Analysis Pipelines:

  • Ensemble analysis approaches combining multiple prediction tools

  • Integrative genomics tools to connect nuoA to metabolic networks

  • Molecular dynamics simulation platforms for membrane protein behavior analysis

How might engineering nuoA contribute to enhanced aromatic compound degradation in bioremediation applications?

Engineering nuoA could potentially enhance bioremediation capabilities:

Potential Engineering Strategies:

  • Directed evolution of nuoA to enhance stability under harsh environmental conditions

  • Site-specific mutations to improve electron transfer efficiency

  • Chimeric proteins incorporating domains from extremophile homologs

  • Co-expression with specialized stress response proteins

Anticipated Benefits:

  • Improved energy efficiency during aromatic degradation

  • Enhanced resistance to oxidative stress generated during pollutant metabolism

  • Better performance in contaminated environments with multiple stressors

  • Extended longevity of bioremediation systems in field applications

Experimental Approach:

  • Create a library of nuoA variants through random or site-directed mutagenesis

  • Screen for improved function under challenging conditions

  • Integrate promising variants into B. xenovorans

  • Assess pollutant degradation efficiency in soil or water microcosms

What insights can comparative analysis of nuoA across Burkholderia species provide for understanding metabolic adaptation?

Comparative analysis of nuoA can reveal evolutionary adaptations:

Evolutionary Patterns:
The B. xenovorans genome shows significant plasticity, with >20% of its sequence acquired through lateral gene transfer. Comparative analysis of nuoA across Burkholderia species can provide insights into how this component has adapted to different ecological niches and metabolic capabilities .

Methodological Approach:

  • Sequence alignment of nuoA across multiple Burkholderia species

  • Phylogenetic analysis to identify evolutionary relationships

  • Selection pressure analysis to identify conserved vs. variable regions

  • Correlation of sequence variations with ecological niches or metabolic capabilities

Expected Insights:

  • Identification of species-specific adaptations in energy metabolism

  • Understanding how nuoA contributes to metabolic flexibility

  • Discovery of potential horizontal gene transfer events involving nuoA

  • Correlation between nuoA variations and aromatic compound degradation capabilities

What role might nuoA play in the remarkable genomic plasticity observed in B. xenovorans?

The genomic context of nuoA provides clues to its evolutionary history:

Genomic Organization:
B. xenovorans LB400 has one of the largest bacterial genomes (9.73-Mbp) with three replicons showing functional specialization. The genomic location of nuoA and surrounding genes can provide insights into its evolutionary history and potential for horizontal transfer .

Comparative Genomic Analysis:
Studies show that B. xenovorans has acquired >20% of its sequence through lateral gene transfer. Analysis of the nuoA genomic region for signs of horizontal gene transfer (unusual GC content, presence of mobile genetic elements) can reveal whether this gene has been subject to such events .

Functional Integration:
The integration of potentially transferred genes into existing metabolic networks requires adaptation. Analysis of nuoA expression patterns and interactions with other proteins can reveal how it has been integrated into B. xenovorans metabolism .

How does the structure-function relationship of nuoA contribute to understanding the entire NADH-quinone oxidoreductase complex?

The structure-function relationship of nuoA provides insights into complex I:

Structural Role:
As a small, hydrophobic subunit with multiple transmembrane domains, nuoA forms part of the membrane arm of complex I. Its precise arrangement relative to other subunits contributes to the proton translocation pathway .

Evolutionary Conservation:
Analysis of conserved residues in nuoA across diverse species can identify amino acids critical for function. These conserved elements likely represent fundamental components of the energy conversion mechanism .

Research Approach:

  • Structural modeling based on homology to solved complex I structures

  • Site-directed mutagenesis of conserved residues

  • Functional assays to correlate structure with activity

  • Cross-linking studies to confirm predicted protein-protein interactions

What are the most promising future research directions for B. xenovorans nuoA?

Several promising research directions emerge:

  • Structural studies: High-resolution structural analysis of B. xenovorans complex I would provide unprecedented insights into how nuoA contributes to energy conservation.

  • Synthetic biology applications: Engineering nuoA as part of efforts to create enhanced bioremediation strains for challenging environmental contaminants.

  • Systems biology integration: Understanding how nuoA functions within the broader context of B. xenovorans metabolism, particularly during aromatic compound degradation.

  • Stress response mechanisms: Further elucidation of how nuoA and the NADH-quinone oxidoreductase complex respond to and mitigate oxidative stress during xenobiotic metabolism.

  • Evolutionary studies: Deeper investigation into the evolutionary history of nuoA and its contribution to the remarkable metabolic versatility of B. xenovorans.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.