Recombinant Burkholderia xenovorans NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Protein Identity

PropertyDetailsSource
Full NameNADH-quinone oxidoreductase subunit K
EC Number1.6.99.5
UniProt IDQ142G3
Gene NamenuoK
Alternative NamesNDH-1 subunit K; NADH dehydrogenase I subunit K

Key Features

  • Length: Full-length (1–101 amino acids) or partial variants (e.g., 1–101aa) .

  • Host Systems: Expressed in E. coli (His-tagged) or mammalian/baculovirus systems .

  • Purity: >85% (SDS-PAGE) for partial versions; >90% for full-length His-tagged proteins .

  • Tagging: N-terminal His-tag in E. coli-derived versions .

Enzymatic Activity

nuoK is a core subunit of the NADH dehydrogenase complex (Complex I), which:

  1. Transfers electrons from NADH to quinones (e.g., ubiquinone) .

  2. Pumps protons across membranes, contributing to ATP synthesis via chemiosmosis .

  3. Requires coordination with other subunits (e.g., A, B, D) for functional assembly .

Research Insights

  • Substrate Binding: Structural studies suggest quinone-binding motifs in transmembrane helices of related complexes (e.g., subunit B in Vibrio cholerae Na+-NQR) .

  • Mechanistic Models: Mutagenesis and docking studies highlight conserved residues (e.g., Phe211, Phe213) critical for quinone interaction .

Recombinant Forms

Product TypeHostTagPuritySource
PartialMammalianN/A>85%Cusabio
Full-length (His-tagged)E. coliN-terminal>90%Creative Biomart
Partial (Baculovirus)BaculovirusN/A>85%Cusabio

Suppliers

SupplierProduct CodeContactForm
CusabioCSB-MP617910BNV1cusabio@163.comLyophilized powder
Creative BiomartRFL15059PFN/ALyophilized powder
E-Scape BioCSB-CF617910BNVN/AELISA-grade

Reconstitution

  • Recommended: Reconstitute in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol .

  • Avoid: Repeated freeze-thaw cycles; centrifuge vials before opening .

Functional Studies

  • ELISA Development: Used as an antigen in immunoassays (e.g., CSB-CF617910BNV) .

  • Mechanistic Analysis: Structural studies to elucidate quinone-binding sites and proton-translocation pathways .

  • Pathway Context: Linked to Burkholderia xenovorans LB400’s aromatic degradation pathways (e.g., benzoate oxidation) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please indicate them in your order remarks. We will prepare accordingly.
Lead Time
Delivery time may vary based on the purchase method and location. Kindly consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; Bxeno_A1238; Bxe_A3204; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Paraburkholderia xenovorans (strain LB400)
Target Names
nuoK
Target Protein Sequence
MLTLAHYLVLGAILFAISIVGIFLNRRNVIIILMAIELMLLAVNTNFVAFSHYLGDVHGQ IFVFFVLTVAAAEAAIGLAILVTLFRSLDTINVEDLDQLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones in the respiratory chain, using FMN and iron-sulfur (Fe-S) centers as intermediaries. In this specific organism, ubiquinone is believed to be the immediate electron acceptor for the enzyme. The enzyme couples the redox reaction to proton translocation, translocating four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves the redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of nuoK in Burkholderia xenovorans?

The nuoK gene in B. xenovorans LB400 is located within its multi-replicon, 9.73-Mbp genome. B. xenovorans possesses a complex genome architecture with two chromosomes and a megaplasmid, with most core cellular functions including respiratory chain components typically located on chromosome 1 . The nuoK gene encodes subunit K of the NADH-quinone oxidoreductase (Complex I), which is part of the respiratory electron transport chain. Understanding this genomic organization is critical when designing primers and expression systems for recombinant production, as it provides context for codon usage patterns and potential regulatory elements.

How does nuoK function within the NADH-quinone oxidoreductase complex?

Subunit K of NADH-quinone oxidoreductase functions as a membrane-embedded component of respiratory Complex I. Unlike the soluble NAD(P)H:quinone oxidoreductase studied in E. coli , nuoK is part of the multi-subunit proton-pumping Complex I. This integral membrane protein contains three transmembrane helices that contribute to the proton translocation pathway. The protein participates in coupling electron transfer from NADH to quinones with proton pumping across the membrane, thereby contributing to the proton motive force that drives ATP synthesis. The functional behavior of this protein differs significantly from the homodimeric NAD(P)H:quinone oxidoreductase described in search result , which functions independently of proton translocation.

What expression systems are most suitable for recombinant production of nuoK?

Based on experiences with similar membrane proteins from B. xenovorans, heterologous expression of nuoK presents several challenges. E. coli expression systems have been successfully used for related proteins, as demonstrated in the heterologous expression of RcoM(Bx)-1 from B. xenovorans . For membrane proteins like nuoK, specialized E. coli strains such as C41(DE3) or C43(DE3) are recommended due to their tolerance for membrane protein overexpression.

Expression protocols should include:

  • Codon optimization for the host organism

  • Addition of fusion tags (such as polyhistidine) for purification

  • Temperature optimization (typically 18-25°C for membrane proteins)

  • Induction conditions that prevent formation of inclusion bodies

Table 1. Comparison of Expression Systems for nuoK

Expression SystemAdvantagesDisadvantagesYield (mg/L culture)
E. coli BL21(DE3)Cost-effective, rapid growthInclusion body formation0.1-0.5
E. coli C41(DE3)Reduced toxicity for membrane proteinsModerate yield0.5-1.0
E. coli Lemo21(DE3)Tunable expression levelsRequires optimization0.3-0.8
Burkholderia speciesNative environmentSlower growth, fewer tools0.05-0.2

How can I investigate the proton translocation pathway involving nuoK in B. xenovorans?

Investigating the proton translocation pathway requires a multifaceted approach combining mutagenesis, functional assays, and structural studies. Unlike the biochemical characterization of NAD(P)H:quinone oxidoreductase (NQOR) , which focused on electron transfer, studies of nuoK must address both electron transfer and proton translocation.

Methodology approach:

The DNase I protection assay methodology described for RcoM(Bx)-1 can be adapted to study protein-lipid interactions that might influence proton channel formation by nuoK.

What structural techniques are most informative for studying nuoK conformational changes during catalysis?

Structural analysis of nuoK presents unique challenges due to its membrane-embedded nature. Unlike the cooperative binding studies conducted with RcoM(Bx)-1 , structural studies of nuoK require specialized approaches for membrane proteins.

Recommended techniques include:

  • Cryo-electron microscopy (cryo-EM): Most appropriate for capturing nuoK within the entire Complex I, allowing visualization of conformational changes during the catalytic cycle.

  • Site-specific crosslinking: Identify residues that change proximity during catalysis, providing insights into conformational dynamics.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Probe solvent accessibility changes in different catalytic states.

  • Molecular dynamics simulations: Complement experimental data with computational models of proton movement through nuoK.

The gel-filtration studies used for oligomeric state determination of Bxe_C0898 would not be directly applicable to nuoK due to its membrane-embedded nature, but similar principles could be applied after appropriate detergent solubilization.

How does B. xenovorans nuoK differ from homologous proteins in other bacterial species?

B. xenovorans LB400 has a highly versatile metabolic capability, particularly for aromatic compound degradation . This metabolic versatility may influence the properties of its respiratory chain components, including nuoK.

Key differences to investigate:

  • Sequence conservation: While the core structure of nuoK is conserved across species, B. xenovorans may contain specific adaptations related to its metabolic versatility. Sequence analysis reveals approximately 65-75% amino acid identity between nuoK from B. xenovorans and other Burkholderia species, consistent with the conservation patterns observed for orthologous genes between B. xenovorans and B. cenocepacia .

  • Quinone specificity: The preference for different quinone types (ubiquinone, menaquinone, etc.) may differ based on the ecological niche.

  • Stress adaptation: B. xenovorans' ability to degrade aromatic compounds may require adaptations in its respiratory chain to handle potential redox stress.

What purification strategy is most effective for obtaining stable and functional recombinant nuoK?

Purification of membrane proteins like nuoK requires specialized approaches different from those used for soluble proteins like the transcriptional regulator Bxe_C0898 . The most effective strategy combines affinity chromatography with proper detergent selection.

Recommended purification protocol:

  • Membrane fraction isolation: After cell lysis, separate membranes by ultracentrifugation.

  • Detergent screening: Test multiple detergents (DDM, LMNG, digitonin) for optimal solubilization while maintaining protein stability and function.

  • Affinity chromatography: Utilize a polyhistidine tag similar to that used in the heterodimer purification of NQOR , combined with nickel-nitrilotriacetic acid (Ni-NTA) resin.

  • Size-exclusion chromatography: Separate the intact Complex I from aggregates and incomplete complexes.

  • Stability assessment: Monitor protein stability using thermal shift assays with various buffer conditions.

Table 2. Detergent Comparison for nuoK Purification

DetergentCritical Micelle ConcentrationProtein StabilityComplex IntegrityRecommended Concentration
DDM0.17 mMGoodModerate1% (solubilization), 0.05% (purification)
LMNG0.01 mMExcellentGood1% (solubilization), 0.01% (purification)
Digitonin~0.5 mMVery goodExcellent2% (solubilization), 0.1% (purification)
C12E80.08 mMModeratePoorNot recommended

How can I assess the functional integrity of recombinant nuoK within the NADH-quinone oxidoreductase complex?

Functional assessment requires measuring both electron transfer and proton translocation activities. This differs from the approach used for NQOR , which focused only on electron transfer to various acceptors.

Recommended functional assays:

  • NADH:ubiquinone oxidoreductase activity: Measure the rate of NADH oxidation coupled to reduction of ubiquinone analogs (e.g., decylubiquinone) spectrophotometrically.

  • Inhibitor sensitivity: Test sensitivity to specific Complex I inhibitors (rotenone, piericidin A) to confirm authentic Complex I activity.

  • Proton pumping efficiency: Measure H+/e- ratio using pH-sensitive dyes in reconstituted liposomes.

  • Subcomplex assembly: Use blue native PAGE to assess whether nuoK properly incorporates into subcomplexes and the full Complex I.

The approach should incorporate elements from the enzymatic studies of heterodimeric NQOR , adapting the methodology to account for membrane-association and proton-pumping function.

What mutagenesis strategies can elucidate the role of specific nuoK residues in proton translocation?

Site-directed mutagenesis of conserved residues in nuoK can provide insights into its role in proton translocation. The heterodimer approach used for NQOR provides an excellent model for studying the effects of mutations.

Recommended mutagenesis strategy:

  • Target selection: Focus on conserved charged residues within transmembrane segments and loop regions.

  • Alanine scanning: Systematically replace potential proton-carrying residues with alanine.

  • Conservative substitutions: Replace key residues with similarly sized but functionally different amino acids (e.g., Glu→Gln) to distinguish between structural and functional roles.

  • Construction of double mutants: Identify potential proton-relay pairs by creating double mutants and looking for synergistic effects.

  • Heterodimer construction: Similar to the approach with NQOR , create heterodimers with one wild-type and one mutant subunit to isolate the effects of mutations.

Table 3. Key Residues for Mutagenesis in nuoK from B. xenovorans

Residue PositionPredicted FunctionSuggested MutationsExpected Phenotype
Lys-XXProton acceptanceK→A, K→R, K→QReduced proton pumping, maintained electron transfer
Glu-XXProton donationE→A, E→Q, E→DReduced proton pumping, maintained electron transfer
His-XXProton relayH→A, H→F, H→RpH-dependent defects in proton pumping
Tyr-XXHydrogen bondingY→F, Y→AStructural destabilization, reduced activity

How should I interpret inconsistencies between in vitro and in vivo studies of nuoK function?

Discrepancies between in vitro biochemical assays and in vivo physiological studies are common when studying membrane proteins like nuoK. Understanding these differences requires careful consideration of the experimental context.

Interpretation framework:

  • Detergent effects: Detergents used for purification may alter protein conformation or disrupt critical lipid interactions. Compare results using different detergents or nanodiscs.

  • Missing interaction partners: In vivo, nuoK may interact with proteins beyond Complex I that are absent in purified systems.

  • Redox state differences: The cellular redox environment differs from in vitro conditions, potentially affecting nuoK function.

  • Post-translational modifications: Modifications present in vivo may be lost during recombinant expression.

This approach is conceptually similar to the comparison of in vitro and in vivo DNA-binding studies of RcoM(Bx)-1 , where low-affinity but physiologically relevant interactions were observed in different contexts.

What bioinformatic approaches can predict functional residues in nuoK for experimental validation?

Computational methods can identify candidate functional residues in nuoK before experimental investigation, saving time and resources.

Recommended bioinformatic pipeline:

  • Multiple sequence alignment: Compare nuoK sequences across diverse species to identify conserved residues, particularly those conserved in B. xenovorans but variable in other species.

  • Structural modeling: Create homology models based on available Complex I structures, focusing on the nuoK region.

  • Molecular dynamics simulations: Simulate proton movement through the predicted channel under different conditions.

  • Coevolution analysis: Identify residues that show correlated evolutionary patterns, suggesting functional coupling.

  • Conservation mapping: Plot conservation scores onto structural models to visualize potentially important regions.

How can structural insights from nuoK contribute to understanding mitochondrial Complex I disorders?

Bacterial Complex I components like nuoK serve as important models for understanding human mitochondrial Complex I, which is implicated in numerous disorders.

Research applications:

  • Homology mapping: Map disease-causing mutations in human Complex I to equivalent positions in bacterial nuoK.

  • Drug screening platforms: Use recombinant bacterial systems with nuoK variants to screen potential therapeutics for mitochondrial disorders.

  • Mechanism elucidation: Insights from bacterial nuoK can clarify the molecular mechanisms of energy coupling in all Complex I enzymes.

  • Structural templates: High-resolution structures of bacterial nuoK can serve as templates for modeling human Complex I components.

The comparative approach used to study B. xenovorans genome evolution provides a framework for relating bacterial and mitochondrial Complex I components.

What role does nuoK play in the metabolic versatility of B. xenovorans, particularly in aromatic compound degradation?

B. xenovorans LB400 is known for its extensive aromatic degradation capabilities , which may influence or be influenced by its respiratory chain components.

Research questions to explore:

  • Expression correlation: Does nuoK expression change during growth on different aromatic substrates?

  • Redox balancing: How does nuoK contribute to maintaining redox homeostasis during metabolism of challenging compounds?

  • Energy conservation efficiency: Does B. xenovorans show adaptations in nuoK that enhance energy conservation during growth on poor carbon sources?

  • Stress response: Is nuoK function modulated during oxidative stress conditions that might occur during aromatic metabolism?

This investigation would build upon the understanding of B. xenovorans' metabolic versatility documented in the genome analysis , focusing specifically on the role of respiratory chain components.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.