Recombinant Burkholderia xenovorans Probable intracellular septation protein A (Bxeno_A2153)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; Bxeno_A2153; Bxe_A2278; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Paraburkholderia xenovorans (strain LB400)
Target Names
Bxeno_A2153
Target Protein Sequence
MKFLFDLFPIILFFVAFKIWGIFTATAVAIVATLVQIAWVAFRHRKVDPMLWVSLGVVTV FGGATLVLHNDTFIKWKPTVLYWAFSVALIVSQLAFNKNLIEAMMGKQITLPHAIWGKLN VVWGVFFVLLGLVNLFVAYNYTTDQWVNFKLFGATGCLVVFIVGQSLWLSKYMKEE
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are recommended for recombinant Bxeno_A2153 production?

Based on successful expression of other B. xenovorans proteins, E. coli represents an effective heterologous expression system for Bxeno_A2153. The RcoMBx-1 protein from B. xenovorans has been successfully expressed in E. coli systems , and similarly, the NADH-quinone oxidoreductase subunit K (NuoK) has been effectively expressed with N-terminal His-tags in E. coli . For optimal expression of Bxeno_A2153, consider the following methodological approach:

  • Clone the full-length coding sequence (or domain-specific regions) into a vector containing an appropriate tag (His-tag is common)

  • Transform into an E. coli strain optimized for protein expression (BL21(DE3) or derivatives)

  • Induce expression using IPTG at concentrations ranging from 5-50 μM, as lower concentrations may yield better results for certain B. xenovorans proteins

  • Perform temperature optimization experiments (typically testing 16°C, 25°C, and 37°C) to determine conditions for maximum soluble protein yield

What are the typical challenges in expressing Bxeno_A2153, and how can they be addressed?

Expression of recombinant bacterial proteins often encounters several challenges:

ChallengeSolution StrategyImplementation Details
Inclusion body formationLower induction temperatureInduce at 16-20°C for 16-24 hours
Reduce inducer concentrationUse 5-10 μM IPTG as shown effective for other B. xenovorans proteins
Use solubility-enhancing tagsSUMO or MBP fusion tags can improve solubility
Protein instabilityOptimize buffer conditionsInclude protease inhibitors and optimize pH based on theoretical pI
Add stabilizing agentsInclude 6% trehalose as used for other B. xenovorans proteins
Low expression levelsCodon optimizationAdapt codons to E. coli preference while maintaining critical regions
Use strong promotersT7 or tac promoters typically yield high expression

What techniques should be employed to characterize the structural properties of purified Bxeno_A2153?

For comprehensive structural characterization of Bxeno_A2153, a multi-technique approach is recommended:

  • Circular Dichroism (CD) Spectroscopy: Determine secondary structure composition (α-helices, β-sheets) under varying conditions (pH, temperature, ligand binding)

  • X-ray Crystallography: Obtain high-resolution three-dimensional structure following optimization of crystallization conditions. Begin with sparse matrix screens at 4°C and 20°C with protein concentrations of 5-15 mg/mL.

  • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS): Determine oligomeric state and potential associations in solution. This is particularly important as septation proteins often function as part of larger complexes.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Analyze protein dynamics and conformational changes upon binding to interacting partners or ligands.

  • Small-Angle X-ray Scattering (SAXS): Obtain low-resolution structural information in solution state, particularly useful if crystallization proves challenging.

Recent studies of bacterial proteins employ combinations of these techniques for comprehensive structural characterization, with particular attention to protein-protein and protein-DNA interactions that may be critical for function .

How can the septation function of Bxeno_A2153 be assessed experimentally?

Assessment of septation function requires both in vitro and in vivo approaches:

In vitro functional assays:

  • GTPase activity assays (if the protein exhibits GTPase activity like septins)

  • Protein-protein interaction assays with other divisome components using techniques such as surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC)

  • Liposome binding assays to assess membrane interaction properties

In vivo functional analysis:

  • Gene knockout/complementation studies to observe phenotypic effects on cell division

  • Fluorescence microscopy using tagged versions of Bxeno_A2153 to visualize localization during cell cycle

  • Time-lapse imaging to track protein dynamics during septation

  • Co-localization studies with other known divisome components

Similar approaches have been used to study other functional aspects of B. xenovorans proteins, such as the DNA-binding properties of RcoMBx-1 . For example, mutagenesis studies combined with in vivo reporter systems have proven effective for functional characterization of B. xenovorans proteins .

What protein stability assays are most informative for Bxeno_A2153 research?

Given that septation proteins must maintain stability for proper function, and drawing from knowledge about septin-mediated protein stabilization , the following methodological approaches are recommended:

How might Bxeno_A2153 interact with the bacterial cell membrane during septation?

Understanding membrane interactions requires specialized methodological approaches:

  • Liposome Binding Assays:

    • Prepare liposomes with compositions mimicking bacterial membranes

    • Assess binding through co-sedimentation or fluorescence-based assays

    • Test effects of lipid composition on binding affinity

  • Atomic Force Microscopy (AFM):

    • Visualize protein-membrane interactions at nanoscale resolution

    • Monitor membrane deformation induced by protein binding

    • Measure binding forces through force spectroscopy

  • Förster Resonance Energy Transfer (FRET):

    • Label Bxeno_A2153 and membrane components with appropriate fluorophores

    • Measure energy transfer to determine proximity and orientation

    • Perform time-resolved experiments to assess dynamics of interactions

  • Molecular Dynamics Simulations:

    • Model interactions between Bxeno_A2153 and lipid bilayers

    • Predict membrane-binding domains and critical residues

    • Guide experimental design for mutagenesis studies

Understanding membrane interactions is particularly important as septins are known to affect the mobility of transmembrane proteins in lipid bilayers , suggesting that Bxeno_A2153 may have similar functions at the bacterial membrane during septation.

What experimental approaches can identify potential binding partners of Bxeno_A2153?

Identify protein-protein interactions using complementary techniques:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Use tagged Bxeno_A2153 as bait to pull down interacting proteins

    • Implement SILAC or TMT labeling for quantitative comparison between conditions

    • Include appropriate controls to filter out non-specific interactions

  • Bacterial Two-Hybrid (B2H) Screening:

    • Screen for interactions against a library of B. xenovorans proteins

    • Validate positive interactions with targeted B2H assays

    • Quantify interaction strength through reporter gene expression

  • Co-Immunoprecipitation (Co-IP) Coupled with Western Blotting:

    • Use antibodies against Bxeno_A2153 or its tag for precipitation

    • Identify specific interacting proteins with targeted antibodies

    • Perform reciprocal Co-IPs to confirm interactions

  • Proximity-Based Labeling (BioID or APEX2):

    • Express Bxeno_A2153 fused to a proximity labeling enzyme

    • Identify proteins in close proximity through biotinylation

    • Compare interactome under different growth conditions

The methodology for studying protein interactions can be informed by approaches used for other B. xenovorans proteins. For example, in studies of RcoMBx-1, researchers used a combination of in vitro binding assays and in vivo functional screens to understand protein interactions .

How do post-translational modifications affect Bxeno_A2153 function and stability?

Analysis of post-translational modifications (PTMs) requires specific methodological approaches:

  • Mass Spectrometry-Based PTM Mapping:

    • Perform LC-MS/MS analysis after enzymatic digestion

    • Use neutral loss scanning for phosphorylation

    • Implement electron transfer dissociation (ETD) for labile modifications

  • Site-Directed Mutagenesis of PTM Sites:

    • Generate phosphomimetic (S/T→D/E) or phosphodeficient (S/T→A) mutants

    • Create lysine mutants (K→R) to prevent ubiquitylation

    • Assess functional consequences through activity assays

  • Phosphoproteomic Analysis:

    • Enrich for phosphopeptides using TiO2 or IMAC

    • Compare phosphorylation patterns under different conditions

    • Identify relevant kinases through inhibitor studies

  • Ubiquitylation Analysis:

    • Use ubiquitin remnant antibodies to enrich ubiquitylated peptides

    • Identify ubiquitylation sites through MS/MS analysis

    • Determine ubiquitin chain types (K48, K63, etc.) and their functional implications

Understanding PTMs is particularly relevant given that septins are known to play roles in protein stabilization by protecting proteins from degradation pathways, including the ubiquitin-proteasome system . If Bxeno_A2153 shares functional similarities with septins, it may be subject to or influence similar regulatory mechanisms.

How does Bxeno_A2153 compare to septation proteins in other bacterial species?

A systematic comparative analysis approach includes:

  • Sequence-Based Phylogenetic Analysis:

    • Perform multiple sequence alignment with homologs from diverse bacteria

    • Generate phylogenetic trees to visualize evolutionary relationships

    • Identify conserved domains and species-specific variations

  • Structural Comparison:

    • Superimpose available structures of homologous proteins

    • Compare binding sites and active regions

    • Identify structural features unique to Bxeno_A2153

  • Functional Conservation Testing:

    • Perform cross-species complementation experiments

    • Express homologs in B. xenovorans knockout strains

    • Assess restoration of function through phenotypic analysis

  • Genomic Context Analysis:

    • Compare gene neighborhoods across species

    • Identify conserved operonic structures

    • Analyze co-evolution with interacting partners

This comparative approach can be particularly informative given that certain DNA-binding motifs in B. xenovorans proteins have been found to be conserved across multiple organisms, suggesting similar functional mechanisms .

What techniques are most effective for studying the dynamics of Bxeno_A2153 in live B. xenovorans cells?

Advanced live-cell imaging techniques provide insights into protein dynamics:

  • Fluorescent Protein Tagging for Live-Cell Imaging:

    • Generate chromosomal fusions with msfGFP or other photostable fluorophores

    • Ensure functionality of tagged constructs through complementation tests

    • Use inducible promoters to control expression levels

  • Super-Resolution Microscopy:

    • Implement PALM/STORM techniques for nanoscale localization

    • Use structured illumination microscopy (SIM) for enhanced resolution

    • Apply lattice light-sheet microscopy for reduced photodamage

  • Single-Molecule Tracking:

    • Use photoactivatable fluorophores for sparse labeling

    • Track individual molecules to determine diffusion coefficients

    • Identify confined movements indicating binding events

  • Fluorescence Recovery After Photobleaching (FRAP):

    • Measure protein turnover rates at septation sites

    • Determine mobile and immobile fractions

    • Compare dynamics under different growth conditions

These approaches can reveal the spatiotemporal dynamics of Bxeno_A2153 during the bacterial cell cycle, providing insights into its function during septation.

How might environmental factors influence Bxeno_A2153 expression and function in B. xenovorans?

Environmental response studies should employ the following methodologies:

  • RNA-Seq Analysis Under Various Conditions:

    • Compare transcription levels across growth phases

    • Assess responses to stress conditions (pH, temperature, nutrients)

    • Identify co-regulated genes in the septation pathway

  • Quantitative Proteomics:

    • Use SILAC or TMT labeling for relative quantification

    • Compare protein abundance across environmental conditions

    • Correlate with transcriptomic data to identify post-transcriptional regulation

  • Chromatin Immunoprecipitation Sequencing (ChIP-Seq):

    • Identify transcription factors regulating Bxeno_A2153 expression

    • Map binding sites within the promoter region

    • Determine condition-specific regulatory mechanisms

  • Reporter Gene Assays:

    • Fuse the Bxeno_A2153 promoter to fluorescent or enzymatic reporters

    • Monitor expression in real-time under changing conditions

    • Identify critical regulatory elements through promoter truncations

Understanding environmental regulation is particularly relevant as B. xenovorans contains sophisticated sensing systems that respond to environmental cues, such as the RcoMBx-1 system that detects carbon monoxide levels . Similar regulatory mechanisms might influence septation protein expression and function.

What strategies can overcome low yields of soluble Bxeno_A2153 in recombinant expression systems?

Methodical optimization approaches include:

  • Expression Host Optimization:

    • Test multiple E. coli strains (BL21(DE3), Rosetta, Arctic Express, SHuffle)

    • Consider alternative hosts (Pseudomonas, Bacillus)

    • Use strains with additional chaperones for improved folding

  • Fusion Tag Screening:

    • Test multiple solubility-enhancing tags (MBP, SUMO, TrxA, GST)

    • Optimize tag position (N-terminal vs. C-terminal)

    • Ensure efficient tag removal with specific proteases

  • Expression Condition Optimization:

    • Perform factorial design experiments varying temperature, inducer concentration, and time

    • Test auto-induction media formulations

    • Implement fed-batch cultivation for higher cell densities

  • Domain-Based Approach:

    • Express individual domains separately

    • Design constructs based on structural predictions

    • Create libraries of truncated constructs for parallel testing

For B. xenovorans proteins, successful expression has been achieved with N-terminal His tags in E. coli , and expression conditions using 5-50 μM IPTG have proven effective for certain proteins .

How can researchers troubleshoot protein-protein interaction studies involving Bxeno_A2153?

A systematic troubleshooting approach includes:

  • Buffer Optimization:

    • Test multiple buffer compositions (pH, ionic strength, additives)

    • Include stabilizing agents like trehalose (6%)

    • Optimize detergent types and concentrations for membrane-associated interactions

  • Protein Quality Assessment:

    • Verify protein folding through circular dichroism

    • Check for aggregation using dynamic light scattering

    • Ensure removal of contaminants through rigorous purification

  • Interaction Condition Screening:

    • Vary protein concentrations to determine optimal ranges

    • Test different temperatures and incubation times

    • Include appropriate controls (non-specific binding partners)

  • Alternative Detection Methods:

    • If one method fails, try complementary approaches

    • Combine in vitro and in vivo techniques for validation

    • Consider label-free methods to avoid tag interference

When studying protein interactions, it's important to note that cooperative binding effects have been observed for B. xenovorans proteins, where binding to one site can influence binding affinity at other sites . This phenomenon should be considered when designing and interpreting interaction studies for Bxeno_A2153.

What emerging technologies could advance our understanding of Bxeno_A2153's role in bacterial cell division?

Several cutting-edge approaches hold promise:

  • Cryo-Electron Tomography:

    • Visualize Bxeno_A2153 in its native cellular context

    • Capture different stages of septation at near-atomic resolution

    • Combine with subtomogram averaging for structural insights

  • CRISPR Interference (CRISPRi):

    • Implement tunable gene repression rather than complete knockout

    • Create depletion strains to study essential functions

    • Perform genome-wide screens to identify genetic interactions

  • In-Cell NMR:

    • Measure protein dynamics and interactions within living cells

    • Monitor structural changes during the cell cycle

    • Identify binding sites and conformational changes in vivo

  • Integrative Structural Biology:

    • Combine X-ray crystallography, cryo-EM, SAXS, and computational modeling

    • Generate comprehensive structural models across different functional states

    • Predict and validate critical residues for function

These approaches can build upon established methodologies used for studying other B. xenovorans proteins, such as the combinatorial in vivo and in vitro approaches used to characterize the RcoMBx-1 transcriptional regulator system .

How might research on Bxeno_A2153 contribute to our broader understanding of bacterial cell division?

The study of Bxeno_A2153 can advance several key areas:

  • Evolutionary Diversity in Division Mechanisms:

    • Compare septation proteins across diverse bacterial phyla

    • Identify conserved core functions versus species-specific adaptations

    • Trace the evolutionary history of bacterial division machinery

  • Coordination of Cell Cycle Events:

    • Investigate temporal regulation of septation protein expression

    • Determine checkpoint mechanisms ensuring proper division timing

    • Uncover links between DNA replication, chromosome segregation, and septation

  • Environmental Adaptation of Division Processes:

    • Study how septation responds to stress conditions

    • Explore division protein regulation under different growth rates

    • Identify condition-specific interaction partners

  • Novel Antimicrobial Target Identification:

    • Assess essentiality of Bxeno_A2153 and homologs

    • Identify species-specific features that could be targeted

    • Screen for inhibitors of critical protein-protein interactions

The mechanisms by which septation proteins function may have parallels to septin-mediated processes in eukaryotes, potentially involving regulation of protein stability and interactions with other cellular components .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.