Recombinant Burkholderia xenovorans Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Description

Amino Acid Sequence and Domains

The UbiB protein sequence (UniProt ID: Q145N7) includes conserved motifs associated with the UbiB family, such as the KxGQ domain and an A-rich loop (Table 2). These features influence nucleotide selectivity and ATPase activity .

FeatureDescriptionSource
KxGQ DomainUnique to UbiB proteins; regulates ATPase activity and CoQ precursor binding
A-rich LoopLimits ATP binding; mutation (A→G) alters ADP/ATP selectivity
N-terminal DomainOccupies substrate-binding pocket, inhibiting kinase activity

ATPase Activity and CoQ Precursor Binding

UbiB exhibits ATPase activity linked to CoQ biosynthesis. In E. coli, UbiB binds octaprenylphenol (OP) and octaprenylhydroxybenzoate (OHB), intermediates in CoQ synthesis . This interaction depends on active-site residues, suggesting a regulatory role in CoQ precursor metabolism .

Role in Ubiquinone Biosynthesis

UbiB is essential for the monooxygenase step in CoQ biosynthesis, catalyzing hydroxylation reactions on prenyl chains . In Paraburkholderia xenovorans, UbiB disruption abolishes CoQ production, leading to OP accumulation .

Pathway Integration

UbiB operates in the ubiquinone biosynthesis pathway (KEGG: bxe00130), which includes:

  1. Shikimate pathway: Provides 4-hydroxybenzoate.

  2. Prenylation: Synthesis of prenyl chains.

  3. Hydroxylation/Methylation: Alternating enzymatic steps regulated by UbiB .

Key Studies

Study FocusFindingsSource
E. coli ubiB MutantsUbiB required for OP hydroxylation; IS1 insertion disrupts ubiB
CoQ Precursor BindingUbiB binds OP/OHB; binding dependent on active-site residues (e.g., K, D)
ATPase ActivityUbiB exhibits ATPase activity; ADP selectivity linked to A-rich loop
CoQ DistributionUbiB homologs (Cqd1/Cqd2) regulate mitochondrial CoQ distribution in yeast

Controversies and Mechanisms

  • Kinase Activity: Despite homology to PKLs, UbiB lacks confirmed kinase activity. Structural studies suggest steric hindrance from the N-terminal domain .

  • ATPase Regulation: ATP hydrolysis may drive conformational changes to facilitate CoQ precursor processing .

Biotechnological and Therapeutic Potential

  • CoQ Biosynthesis Studies: Recombinant UbiB enables in vitro analysis of CoQ precursor hydroxylation .

  • Disease Modeling: UbiB homologs (e.g., COQ8A in humans) are implicated in neurodegenerative and kidney disorders, making them therapeutic targets .

  • Small-Molecule Modulators: Inhibitors like UNC-CA157 selectively target COQ8A, offering tools to study UbiB function .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ubiB; Bxeno_A0414; Bxe_A4047; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-525
Protein Length
full length protein
Species
Paraburkholderia xenovorans (strain LB400)
Target Names
ubiB
Target Protein Sequence
MRFLRFLKIFFTVIRFGLDEMMLSRVNDRRVRLLLRITTIGRKFDAPPGVRLRLALESLG PIFVKFGQVLSTRRDLLPVDIANELAKLQDQVPPFDSAVAIGLVEKSLGAPVDVLFDDFE RVPVASASIAQVHFATVKAGQHAGKAVAVKVLRPNMLPVIDSDLALLRDIAVWAERLWAD GKRLKPREVVAEFDKYLHDELDLMREAANGSQLRRNFAGLDLLLVPEMYWEFCTPTVLVM ERMVGVPISQVETLRAAGVDIPKLAREGVEIFFTQVFRDGFFHADMHPGNIQVSLDPAHF GRYIALDFGIIGALSDFDKNYLAQNFLAFFKRDYHRVATLHLESGWVPPTTRVEELESAI RAVCEPYFDRALKDISLGQVLMRLFSTSRRFNVEIQPQLVLLQKTMLNVEGLGRSLDPEL DLWKTAKPYLERWMNEQIGLRGWYERLKIEAPQWSKTLPQLPRLIHHALAERHDHTRGAN DEMIRQILLEQKRTNRLLQGLLLFGVAVGVGAALARVFLALAYGG
Uniprot No.

Target Background

Function
This protein is likely a kinase regulator of UbiI, involved in aerobic coenzyme Q (ubiquinone) biosynthesis.
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Burkholderia xenovorans and why is it significant for UbiB research?

Burkholderia xenovorans LB400 is a non-pathogenic bacterial strain with one of the largest known bacterial genomes (9.73 Mbp) and represents the first sequenced non-pathogenic Burkholderia isolate . This organism is particularly well-studied as an effective polychlorinated biphenyl (PCB) degrader, having been isolated from a PCB-containing landfill in New York State . The large genome size of B. xenovorans provides a rich genetic landscape for studying metabolic proteins like UbiB.

B. xenovorans belongs to the Burkholderia graminis clade, with members most commonly found in the rhizosphere of grass plants . Unlike pathogenic Burkholderia species that have been extensively studied, B. xenovorans offers researchers an opportunity to investigate ubiquinone biosynthesis in a non-pathogenic model that exhibits remarkable metabolic versatility. The organism's extensive aromatic degradation pathways (at least eleven "central aromatic" and twenty "peripheral aromatic" pathways) suggest a metabolic flexibility that likely depends on efficient energy generation systems, including ubiquinone-dependent respiration .

What is the function of ubiquinone biosynthesis protein UbiB in bacterial systems?

UbiB plays a critical role in the biosynthesis of ubiquinone (coenzyme Q), which serves as an essential electron carrier in the respiratory chain and is particularly important for aerobic and facultative anaerobic bacteria. According to research findings, UbiB functions as a protein with ATPase activity involved in the ubiquinone biosynthetic pathway . It participates in a multiprotein complex for ubiquinone biosynthesis along with other proteins such as UbiJ and UbiK .

Ubiquinone itself serves as the terminal electron acceptor in aerobic respiration and acts as a co-substrate in its own biosynthesis . The importance of ubiquinone extends beyond respiration to include roles in redox homeostasis and oxidative stress management. UbiB's specific enzymatic function appears to be providing energy through ATP hydrolysis for certain steps in the biosynthetic pathway, although the precise biochemical mechanisms remain an active area of research.

How is recombinant UbiB protein typically produced for research purposes?

Recombinant UbiB protein is typically produced using heterologous expression systems, with E. coli being the most commonly employed host organism. Based on the available search results and established recombinant protein methodology, a standard production protocol would include:

  • Gene cloning: The ubiB gene from Burkholderia xenovorans is amplified by PCR with specific primers designed based on the published genomic sequence.

  • Vector construction: The amplified gene is inserted into an expression vector containing appropriate promoters and fusion tags. Based on available recombinant protein information, His-tagging is commonly used for UbiB purification .

  • Transformation: The recombinant vector is transformed into an E. coli expression strain optimized for protein production.

  • Expression induction: Protein expression is induced under optimized conditions, often using IPTG for T7 promoter-based systems.

  • Cell harvest and lysis: Bacterial cells are harvested by centrifugation and lysed using appropriate methods.

  • Protein purification: The His-tagged UbiB protein is purified using nickel affinity chromatography as the primary purification step .

  • Quality control: The purified protein is typically analyzed by SDS-PAGE for purity assessment, with a target purity of greater than 90% .

The purified recombinant UbiB is often stored as a lyophilized powder or in a stabilizing buffer containing components like trehalose to maintain protein integrity . For long-term storage, aliquoting and storage at -20°C/-80°C is recommended, with repeated freeze-thaw cycles being discouraged to preserve protein activity .

What are the structural characteristics of UbiB from Burkholderia xenovorans?

While a complete crystal structure of B. xenovorans UbiB is not described in the provided search results, structural information can be inferred from homologous proteins and sequence data. Based on available data for the Burkholderia mallei UbiB homolog, the protein is a full-length protein consisting of 525 amino acids . The amino acid sequence reveals several important structural features:

The protein contains multiple hydrophobic regions that may be involved in membrane association, which is consistent with ubiquinone's localization in the bacterial membrane. The sequence also suggests the presence of ATP-binding domains, aligning with UbiB's reported ATPase activity . A notable characteristic of UbiB is its involvement in protein complexes with other ubiquinone biosynthesis enzymes, indicating the presence of protein-protein interaction domains .

The predicted secondary structure likely includes both alpha-helical and beta-sheet elements typical of enzymes involved in energy-coupling reactions. Conservative sequence motifs across different bacterial species suggest functionally important regions that have been maintained throughout evolution.

How does the genome organization of Burkholderia xenovorans affect the expression of UbiB?

The genome of Burkholderia xenovorans LB400 has a multi-replicon structure consisting of three replicons with a total size of 9.73 Mbp . This complex genomic organization significantly impacts gene expression patterns, including those of metabolic genes like ubiB. Several key factors influence UbiB expression in the context of this genomic architecture:

From an evolutionary perspective, there are significant differences in functional specialization between the three replicons of LB400, as well as a more relaxed selective pressure for genes located on the two smaller replicons versus the largest replicon . Depending on which replicon harbors the ubiB gene, its expression patterns and evolutionary constraints may differ.

The genome shows extensive evidence of lateral gene transfer, with findings indicating that more than 20% of the LB400 sequence was recently acquired through horizontal gene transfer . This genomic plasticity may influence the regulation of ubiquinone biosynthesis genes if they were acquired horizontally or if their regulatory elements were affected by such events.

Additionally, B. xenovorans exhibits significant gene redundancy, with 17.6% of proteins having a better paralog within the same genome than an ortholog in a different genome . This raises questions about potential functional redundancies in ubiquinone biosynthesis pathways, which may affect how UbiB is expressed and regulated under different conditions.

How do oxygen-dependent and oxygen-independent ubiquinone biosynthesis pathways differ, and what is UbiB's role in each?

Bacteria have evolved two distinct pathways for ubiquinone biosynthesis that function under different oxygen conditions, reflecting their adaptation to environments with varying oxygen availability:

Oxygen-dependent pathway:
This classic pathway requires molecular oxygen (O₂) as a co-substrate for hydroxylation reactions in the biosynthesis of ubiquinone . Oxygen acts as the terminal electron acceptor in aerobic respiration and serves as a co-substrate in the biosynthesis process itself . In this pathway, UbiB functions as an ATPase, likely providing energy for specific biosynthetic steps . The pathway involves monooxygenases that incorporate oxygen atoms directly into precursor molecules.

Oxygen-independent pathway:
This novel pathway allows for ubiquinone biosynthesis in the absence of molecular oxygen, representing a significant adaptation for bacteria that inhabit anaerobic or microaerobic environments . This pathway relies on three proteins: UbiT (YhbT), UbiU (YhbU), and UbiV (YhbV) . While UbiT contains an SCP2 lipid-binding domain and likely acts as an accessory factor, UbiU and UbiV form a heterodimer involved in hydroxylation reactions and represent a novel class of O₂-independent hydroxylases . Both UbiU and UbiV bind a 4Fe-4S cluster via conserved cysteines that are essential for activity .

UbiB's precise role may differ between these pathways. In the O₂-dependent pathway, its ATPase activity supports energy-dependent reactions. In the O₂-independent pathway, UbiB may interact with the UbiU-UbiV complex, potentially contributing to the alternative hydroxylation mechanism. The existence of both pathways enables bacteria like Burkholderia species to synthesize ubiquinone across the entire oxygen range, optimizing bacterial metabolism regardless of oxygen availability .

What experimental approaches are most effective for studying UbiB protein-protein interactions in the ubiquinone biosynthesis complex?

Studying UbiB protein-protein interactions within the ubiquinone biosynthesis complex requires a multi-faceted approach that accounts for the potential membrane association and dynamic nature of these interactions. Based on current research methodologies, the following approaches are most effective:

Co-immunoprecipitation (Co-IP):
By expressing UbiB with an epitope tag (such as the His-tag used in recombinant systems ), researchers can pull down UbiB along with its interacting partners from bacterial lysates. The interacting proteins can then be identified by mass spectrometry. This approach has been successful in identifying components of multiprotein UQ biosynthesis complexes, as demonstrated with UbiJ and UbiK .

Bacterial two-hybrid (B2H) system:
This approach allows for the detection of protein-protein interactions in a bacterial cellular environment. By creating fusion constructs of UbiB and potential interacting partners with complementary fragments of a reporter protein, interactions can be monitored through reporter gene activation. This is particularly useful for screening multiple potential partners.

Crosslinking coupled with mass spectrometry (XL-MS):
Chemical crosslinkers can stabilize transient protein-protein interactions before cell lysis, allowing for the capture of interactions that might be lost during traditional purification approaches. The crosslinked complexes can then be analyzed by mass spectrometry to identify not only the interacting partners but also the specific interaction interfaces.

Surface Plasmon Resonance (SPR) or Microscale Thermophoresis (MST):
These biophysical methods can quantitatively measure direct interactions between purified UbiB and potential partner proteins, providing binding kinetics and affinity constants. They are particularly valuable for confirming interactions identified through other approaches and for testing the effects of mutations on interaction strength.

Cryo-electron microscopy:
For structural characterization of the entire ubiquinone biosynthesis complex, cryo-EM offers the ability to visualize the arrangement of UbiB relative to other components while maintaining the complex in a near-native state. This approach has revolutionized the structural biology of large protein complexes and could provide valuable insights into how UbiB interfaces with other ubiquinone biosynthesis proteins.

How do gene duplication and lateral gene transfer events impact the evolution of UbiB and ubiquinone biosynthesis in Burkholderia species?

The evolution of UbiB and ubiquinone biosynthesis in Burkholderia species has been significantly shaped by gene duplication and lateral gene transfer (LGT) events, as evidenced by genomic analyses of B. xenovorans LB400:

Impact of Gene Duplication:
The search results indicate that 17.6% of B. xenovorans LB400 proteins have a better paralog within the same genome than an ortholog in a different genome . This high rate of paralogy suggests frequent gene duplication events. In the context of ubiquinone biosynthesis, duplication events can lead to subfunctionalization, where the original function is divided among paralogs, or neofunctionalization, where one copy evolves a new function while the other retains the original role.

The experimentally observed redundancy in metabolic pathways, such as benzoate degradation and formaldehyde oxidation, highlights the importance of gene duplication and repeated acquisition in B. xenovorans . This redundancy, coupled with subsequent divergence of duplicated genes, raises fundamental questions about the role of paralogs and potential functional redundancies in large-genome microbes like B. xenovorans .

Impact of Lateral Gene Transfer:
Over 20% of the B. xenovorans LB400 sequence was recently acquired through lateral gene transfer . This extensive horizontal acquisition contributes significantly to the metabolic diversity observed in this species. For ubiquinone biosynthesis pathways, LGT may have introduced novel variants or components from distantly related organisms, potentially contributing to the development of alternative pathways like the O₂-independent ubiquinone biosynthesis system.

The diversity and plasticity within the Burkholderia genus are exemplified by the conservation of only 44% of genes between LB400 and Burkholderia cepacia complex strain 383 . Even among four B. xenovorans strains, genome size varies considerably from 7.4 to 9.73 Mbp . This variability suggests that ubiquinone biosynthesis pathways may differ significantly across Burkholderia species due to differential acquisition and retention of genes.

Understanding these evolutionary mechanisms provides crucial context for interpreting functional studies of UbiB and may explain observed differences in ubiquinone biosynthesis capabilities across bacterial species.

What are the methodological challenges in expressing and purifying functional recombinant UbiB protein, and how can they be overcome?

Expressing and purifying functional recombinant UbiB protein presents several methodological challenges that must be addressed to obtain high-quality protein for research purposes:

Protein Solubility Issues:
UbiB may form inclusion bodies during overexpression, particularly if it contains membrane-associating domains. To overcome this challenge, researchers can employ strategies such as lowering the induction temperature (16-25°C), using solubility-enhancing fusion partners (such as SUMO or MBP), or optimizing expression parameters including inducer concentration and duration. The use of specialized E. coli strains designed for expressing challenging proteins may also improve solubility.

Protein Stability Concerns:
According to available information on recombinant UbiB protein, stability is a significant concern, with recommendations to avoid repeated freeze-thaw cycles . To address stability issues, researchers should identify optimal buffer conditions through thermal shift assays and include appropriate stabilizing additives. The use of trehalose in storage buffers, as mentioned in the product specifications , is one approach to enhancing stability. Aliquoting the purified protein and storing at -80°C is also recommended to prevent degradation .

ATPase Activity Retention:
Given UbiB's ATPase function , maintaining enzymatic activity during purification is critical. This can be achieved by including ATP or non-hydrolyzable analogs during purification to stabilize the active site, avoiding harsh elution conditions that might denature active sites, and verifying activity immediately after each purification step.

Protein-Protein Interactions:
Since UbiB functions in a multiprotein complex for ubiquinone biosynthesis , isolation of the protein alone may not capture its full functional context. Co-expression with known interaction partners or use of gentle purification methods that preserve protein-protein interactions may help maintain the biological relevance of the purified protein.

A recommended purification protocol based on available information would include:

  • Expression with a His-tag for purification purposes

  • Affinity chromatography using nickel resin

  • Buffer optimization to include stabilizing agents like trehalose

  • Storage at -20°C/-80°C in small aliquots to prevent repeated freeze-thaw cycles

  • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol for long-term storage

How can researchers effectively study the differential expression of UbiB under various oxygen conditions in Burkholderia xenovorans?

Studying the differential expression of UbiB under various oxygen conditions requires a systematic approach that captures the bacterium's response to changing oxygen levels:

Experimental Design for Oxygen Gradient Studies:

Oxygen ConditionpO₂ Range (%)Culture SystemExpected UbiB Regulation
Strictly Anaerobic0Sealed anaerobic chamberMay be upregulated if involved in O₂-independent pathway
Microaerobic0.5-2Controlled bioreactorPotentially highest expression level
Low Aerobic2-10Reduced aeration flasksModerate expression
Fully Aerobic21 (atmospheric)Standard shaking flasksBaseline expression

Molecular Methods for Expression Analysis:

  • RNA-Seq: This approach provides a comprehensive view of the transcriptome, allowing researchers to place ubiB expression in the context of global oxygen response patterns. It can reveal co-regulated genes and potential regulatory networks.

  • RT-qPCR: For precise quantification of ubiB mRNA levels across oxygen conditions, RT-qPCR offers high sensitivity and specificity. This method is particularly useful for validating RNA-Seq findings and for time-course experiments tracking expression changes during oxygen transitions.

  • Proteomics: Mass spectrometry-based proteomics can quantify UbiB protein levels directly, providing information about post-transcriptional regulation. This approach can also identify post-translational modifications that might regulate UbiB activity under different oxygen conditions.

  • Reporter Systems: Constructing fusions between the ubiB promoter and reporter genes (such as GFP or luciferase) allows for real-time monitoring of gene expression in living cells as they respond to changing oxygen levels.

  • ChIP-seq: This technique can identify transcription factors binding to the ubiB promoter under different oxygen conditions, providing mechanistic insights into oxygen-dependent regulation.

To ensure robust results, researchers should include appropriate controls such as known oxygen-responsive genes, monitor dissolved oxygen continuously during experiments, and include sufficient biological and technical replicates for statistical validity. Integration of transcriptomic and proteomic data provides the most comprehensive understanding of how oxygen availability influences UbiB expression in B. xenovorans.

What role does UbiB play in the adaptation of Burkholderia xenovorans to environments with fluctuating oxygen levels?

UbiB likely plays a critical role in the adaptation of B. xenovorans to environments with fluctuating oxygen levels through several mechanisms:

Pathway Switching Support:
The existence of both O₂-dependent and O₂-independent pathways for ubiquinone biosynthesis allows bacteria to synthesize this essential electron carrier regardless of oxygen availability . UbiB, with its ATPase activity , may provide energy necessary for pathway transitions, enabling efficient shifting between aerobic and anaerobic biosynthetic routes as oxygen levels fluctuate.

Metabolic Flexibility:
B. xenovorans exhibits remarkable metabolic versatility, with numerous aromatic degradation pathways that require flexible energy metabolism . The presence of at least eleven "central aromatic" and twenty "peripheral aromatic" pathways in LB400, among the highest in any sequenced bacterial genome, suggests a significant energetic demand . UbiB's role in ensuring consistent ubiquinone production supports this metabolic plasticity by maintaining energy production capabilities across oxygen gradients.

Ecological Niche Adaptation:
B. xenovorans belongs to the B. graminis clade, with members commonly found in the rhizosphere of grass plants . This environment is characterized by oxygen gradients that change with soil depth, moisture content, and plant respiration rates. UbiB's contribution to functional ubiquinone biosynthesis across these gradients likely supports the organism's ability to colonize and persist in this ecological niche.

Genetic Factors for Environmental Persistence:
Although B. xenovorans possesses genetic factors associated with in vivo survival and intercellular interactions, these factors are likely related to niche breadth rather than pathogenicity . UbiB may be one such factor, contributing to the organism's ability to thrive in diverse environments with varying oxygen availability.

Understanding UbiB's role in oxygen adaptation not only provides insights into B. xenovorans ecology but may also inform biotechnological applications, particularly in bioremediation of contaminated environments where oxygen gradients are common.

How do mutations in the UbiB gene affect ubiquinone biosynthesis and bacterial physiology in Burkholderia species?

Mutations in the UbiB gene can have profound effects on ubiquinone biosynthesis and bacterial physiology in Burkholderia species:

Impact on Ubiquinone Biosynthesis:

Mutation TypeExpected Effect on Ubiquinone BiosynthesisDetection Method
Null mutations (deletion, frameshift)Severe impairment of the O₂-dependent pathwayHPLC quantification of ubiquinone
Active site mutationsReduced ATPase activity and biosynthetic efficiencyEnzyme activity assays
Regulatory region mutationsAltered expression patterns under different conditionsqPCR, reporter assays
Interaction domain mutationsDisrupted complex formation with other biosynthetic proteinsCo-immunoprecipitation

Physiological Consequences:

  • Energy Metabolism Disruption:
    Reduced ubiquinone levels would impair electron transport chain function, leading to decreased ATP production through oxidative phosphorylation. This would likely cause growth defects under aerobic conditions and potentially shift metabolism toward fermentation or alternative respiratory pathways.

  • Oxidative Stress Sensitivity:
    Ubiquinone possesses antioxidant properties that help protect cells from oxidative damage. UbiB mutants with reduced ubiquinone production may show increased sensitivity to oxidative stressors and redox-active compounds.

  • Aromatic Compound Metabolism:
    Given B. xenovorans' extensive aromatic degradation capabilities , disruptions in energy metabolism due to UbiB mutations could impair the organism's ability to metabolize complex aromatic compounds, including PCBs. This connection between energy metabolism and xenobiotic degradation represents an important link between UbiB function and the organism's ecological role.

  • Adaptation Mechanisms:
    In response to UbiB mutations, bacteria may activate compensatory mechanisms, including upregulation of the O₂-independent ubiquinone biosynthesis pathway , increased expression of alternative respiratory complexes, or metabolic rewiring to maintain energy homeostasis.

Studying UbiB mutations provides valuable insights into both the protein's specific role in ubiquinone biosynthesis and its broader impact on bacterial physiology, potentially revealing new targets for metabolic engineering or antimicrobial development.

What bioinformatic approaches are most valuable for analyzing UbiB homologs across bacterial species and predicting functional variations?

Comprehensive bioinformatic analysis of UbiB homologs requires multiple computational approaches to gain insights into evolutionary relationships, structural features, and functional predictions:

Sequence-Based Analysis:
Multiple Sequence Alignment (MSA) of UbiB homologs from diverse bacterial species can identify conserved residues likely essential for function. This is particularly important given the high genomic diversity within the Burkholderia genus, where only 44% of genes are conserved between B. xenovorans LB400 and B. cepacia complex strain 383 . Phylogenetic tree construction from these alignments can establish evolutionary relationships between UbiB variants and potentially identify functional clades.

Structural Prediction:
Homology modeling based on crystal structures of related proteins can predict the 3D structure of UbiB from different species. This is valuable for identifying potential ATP-binding sites, catalytic residues, and interaction interfaces. Molecular dynamics simulations can further analyze conformational dynamics and stability differences between variants.

Genomic Context Analysis:
Examining the genomic neighborhood of ubiB genes across species can reveal conserved gene clusters and potential functional associations. This approach is particularly relevant given B. xenovorans' multi-replicon genome structure and the significant differences in functional specialization between replicons . Synteny analysis can identify whether ubiB consistently co-occurs with other ubiquinone biosynthesis genes.

Comparative Genomics:
Pan-genome analysis can determine core and accessory UbiB variants across bacterial species. This is especially informative given the finding that genome size varies from 7.4 to 9.73 Mbp even among four B. xenovorans strains . Such analysis can help understand how gene duplication and lateral gene transfer, which accounts for >20% of the LB400 sequence , have shaped UbiB evolution.

By integrating these bioinformatic approaches, researchers can gain comprehensive insights into UbiB's evolutionary history, predict functional variations across species, and generate testable hypotheses for experimental validation.

How can metabolomic approaches be used to characterize the impact of UbiB on the cellular metabolome in Burkholderia xenovorans?

Metabolomic approaches offer powerful tools for characterizing how UbiB affects the cellular metabolome in Burkholderia xenovorans:

Experimental Design for Metabolomic Studies:

ComparisonPurposeExpected Metabolic Signatures
Wild-type vs. UbiB knockoutDetermine direct metabolic consequences of UbiB absenceChanges in ubiquinone, precursors, and energy metabolism intermediates
UbiB overexpression vs. wild-typeIdentify rate-limiting steps in biosynthesisAltered flux through ubiquinone pathway
Aerobic vs. anaerobic conditionsAssess oxygen-dependent metabolic shiftsDifferential activation of O₂-dependent vs. independent pathways
Time-course during oxygen transitionsCapture dynamic metabolic adaptationsTemporal sequence of metabolite changes

Analytical Platforms:

  • Liquid Chromatography-Mass Spectrometry (LC-MS): This technique offers high sensitivity for detecting ubiquinone and its precursors, along with thousands of other metabolites. Targeted LC-MS/MS can be used for precise quantification of specific pathway intermediates.

  • Gas Chromatography-Mass Spectrometry (GC-MS): Particularly valuable for analyzing TCA cycle intermediates, fatty acids, and other primary metabolites affected by changes in respiratory chain function due to altered ubiquinone levels.

  • Nuclear Magnetic Resonance (NMR) Spectroscopy: Provides structural confirmation of metabolites and is excellent for isotope labeling studies to track metabolic flux through pathways.

Specific Approaches:

  • Stable Isotope Labeling: Using ¹³C-labeled precursors allows tracking of carbon flow through the ubiquinone biosynthesis pathway and connected metabolic networks. This can reveal how UbiB affects flux distribution and identify potential bottlenecks or branch points.

  • Flux Balance Analysis: Developing computational models that incorporate metabolomic data can predict how UbiB perturbations affect global metabolism, helping to interpret complex datasets and generate hypotheses for further testing.

  • Multi-omics Integration: Correlating metabolomic data with transcriptomic and proteomic datasets provides a comprehensive view of how UbiB influences cellular physiology, connecting changes in gene expression to metabolic outcomes.

By implementing these metabolomic approaches, researchers can comprehensively characterize how UbiB influences the cellular metabolome in B. xenovorans, providing insights into its role in energy metabolism, aromatic compound degradation, and adaptation to changing environmental conditions.

What are the current challenges and future directions in understanding the role of UbiB in bacterial adaptation and metabolism?

Research on UbiB's role in bacterial adaptation and metabolism faces several significant challenges while also offering promising directions for future investigation:

Current Challenges:

  • Structural Characterization: Limited high-resolution structural data for UbiB proteins hampers understanding of the molecular mechanisms underlying its ATPase activity and interactions with other proteins in the ubiquinone biosynthesis complex.

  • Functional Redundancy: The experimental redundancy observed in metabolic pathways in B. xenovorans and the presence of both O₂-dependent and O₂-independent ubiquinone biosynthesis pathways create challenges in distinguishing primary from secondary effects in UbiB mutants.

  • Ecological Context: While B. xenovorans has been well-studied for PCB degradation, understanding how UbiB function relates to the organism's performance in its natural rhizosphere habitat requires further investigation.

  • Species Variations: The high genomic plasticity, diversity, and specialization within the Burkholderia genus suggest possible variations in UbiB function across species that remain to be characterized.

Future Research Directions:

  • Systems Biology Approaches: Implementing genome-scale metabolic models incorporating ubiquinone biosynthesis can predict metabolic outcomes of UbiB perturbations and guide experimental design. This is particularly relevant given B. xenovorans' complex metabolic network with numerous aromatic degradation pathways .

  • Advanced Structural Studies: Applying cryo-electron microscopy to determine UbiB structure in complex with other ubiquinone biosynthesis proteins could provide crucial insights into functional mechanisms and protein-protein interactions.

  • Ecological and Evolutionary Studies: Investigating UbiB function in Burkholderia strains from different environments could reveal how this protein contributes to niche adaptation and metabolic flexibility. This aligns with findings that genetic factors in B. xenovorans are likely related to niche breadth rather than pathogenicity .

  • Synthetic Biology Applications: Engineering UbiB variants with enhanced activity or altered specificity could lead to biotechnological applications, particularly in bioremediation where B. xenovorans' metabolic capabilities are already valued.

  • Integrative Multi-omics: Combining transcriptomic, proteomic, and metabolomic data to build comprehensive models of how UbiB functions within the larger context of cellular metabolism represents a powerful approach for future research.

Addressing these challenges and pursuing these future directions will significantly advance our understanding of UbiB's role in bacterial metabolism and adaptation, potentially leading to novel applications in biotechnology, medicine, and environmental science.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.