Recombinant Buxus microphylla Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your specifications.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Buxus microphylla (Littleleaf boxwood) (Japanese boxwood)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPLDIEVPQAVLPDTVFEAVVRIPYDMQLKQV LANGKKGALNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQSYRPTKKNILVIGPVPG QKYSEITFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIIS KIIRKEKGGYEITIADASDGHQVVNIIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFFASVILAQIFLVLKKKQFEKVQLSEMNF
Uniprot No.

Target Background

Function
Recombinant Buxus microphylla Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f (petA) and what role does it play in Buxus microphylla?

Apocytochrome f is the precursor protein of cytochrome f, a critical component of the cytochrome b6f complex involved in the electron transport chain during photosynthesis. In Buxus microphylla (littleleaf boxwood), as in other plants, this protein facilitates electron transfer between photosystem II and photosystem I. The petA gene encodes this protein, which is initially synthesized as apocytochrome f before post-translational modification. Buxus microphylla, being an evergreen shrub with distinctive photosynthetic capacity across varying light conditions, relies on efficient electron transport systems maintained partly through the functionality of cytochrome f . The protein's structure-function relationship enables its performance across the variable environmental conditions in which Buxus microphylla thrives, from full sun to shade environments.

How does Buxus microphylla Apocytochrome f differ from other plant species?

Buxus microphylla Apocytochrome f maintains the conserved structural domains characteristic of this protein across plant species, but with notable adaptations that potentially contribute to the plant's environmental versatility. The protein's sequence variations may reflect adaptations to the broad climate suitability of Buxus microphylla, which can thrive across USDA hardiness zones 6 through 10A . Unlike some other species, Buxus has evolved specialized biochemical adaptations that may be reflected in its photosynthetic electron transport components, potentially contributing to its unusual tolerance for both full sun and deep shade conditions, a versatility not seen in many woody ornamentals. These adaptations may involve subtle structural modifications to electron transport proteins, including cytochrome f, though specific comparative analyses would be needed to identify precise sequence and functional divergences.

What are the basic properties of recombinant Buxus microphylla Apocytochrome f?

Recombinant Buxus microphylla Apocytochrome f, when expressed in appropriate host systems, typically presents as a membrane-associated protein with a molecular weight of approximately 30-35 kDa before post-translational modifications. Its isoelectric point generally falls in the range of 5.0-6.0, reflecting its acidic nature. The recombinant protein retains the characteristic heme-binding domain and membrane-spanning region found in native apocytochrome f, though without the addition of the heme group that would convert it to mature cytochrome f. The protein demonstrates relative stability under standard laboratory conditions when properly prepared, though it tends to aggregate in aqueous solutions without appropriate detergents or membrane mimetics due to its hydrophobic regions. Buxus microphylla's adaptation to varied environmental conditions from sun to shade suggests potential structural features that confer stability across different cellular environments .

What are the most effective protocols for isolating the petA gene from Buxus microphylla?

The most effective isolation protocol for the petA gene from Buxus microphylla involves a multi-step process beginning with high-quality genomic DNA extraction. Given the presence of phenolic compounds and secondary metabolites in Boxwood species that can inhibit downstream applications, a modified CTAB (cetyltrimethylammonium bromide) extraction method with the addition of polyvinylpyrrolidone (PVP) and β-mercaptoethanol is recommended to mitigate these inhibitory effects.

For PCR amplification of the petA gene, degenerate primers designed from conserved regions of petA sequences from related species provide the best starting point. Touchdown PCR protocols have shown superior results for amplifying genes from woody plants with complex secondary chemistry like Buxus microphylla. The typical protocol would include:

  • Initial denaturation at 95°C for 5 minutes

  • 10 cycles of touchdown PCR: 94°C for 30 seconds, 65°C (decreasing by 1°C per cycle) for 45 seconds, 72°C for 90 seconds

  • 25 cycles of standard PCR: 94°C for 30 seconds, 55°C for 45 seconds, 72°C for a time corresponding to the expected amplicon length

  • Final extension at 72°C for 10 minutes

Following successful amplification, cloning the PCR product into a suitable vector system facilitates sequence verification before proceeding to expression studies. This approach circumvents challenges associated with the unique chemical composition of Buxus tissues that might interfere with direct gene isolation .

Which expression systems are optimal for producing recombinant Buxus microphylla Apocytochrome f?

The optimal expression systems for producing recombinant Buxus microphylla Apocytochrome f depend on the research objectives, but several systems have demonstrated particular efficacy:

Expression SystemAdvantagesLimitationsYield (mg/L culture)Special Considerations
E. coli (BL21(DE3))High yield, rapid growth, economicalLacks post-translational modifications, inclusion body formation5-15Requires optimization of solubility with fusion tags and specialized membrane mimetics
Insect cell (Sf9)Better protein folding, some post-translational modificationsMore expensive, longer culture time2-8Superior for functional studies requiring properly folded protein
Plant-based (N. benthamiana)Native-like modifications, membrane integrationLower yields, technically demanding0.5-3Best for structural studies requiring authentic conformation

Temperature optimization is particularly critical - expression at 16-18°C after induction significantly reduces inclusion body formation in bacterial systems, especially important for membrane proteins like apocytochrome f .

What purification challenges are specific to Buxus microphylla Apocytochrome f and how can they be overcome?

Purification of recombinant Buxus microphylla Apocytochrome f presents several distinct challenges, primarily stemming from its membrane-associated nature and tendency to form aggregates. These challenges can be systematically addressed through a tailored purification protocol:

  • Solubilization challenges: The hydrophobic domains of apocytochrome f lead to aggregation during extraction. This can be overcome using a combination of detergents - typically 1% n-dodecyl β-D-maltoside (DDM) supplemented with 0.2% cholesteryl hemisuccinate (CHS) provides optimal solubilization while preserving protein structure.

  • Protein stability during purification: Apocytochrome f demonstrates significant instability outside its native membrane environment. Including 10% glycerol and 5 mM β-mercaptoethanol in all purification buffers substantially improves stability.

  • Contamination with host proteins: For affinity purification, a dual-tag approach using both His6 and StrepII tags enables a two-step purification process that dramatically reduces contaminating proteins. The typical recovery efficiency increases from 60% with single-tag approaches to >85% with the dual-tag strategy.

  • Verification of native conformation: Circular dichroism spectroscopy provides a reliable method to confirm proper folding of the purified protein, with characteristic peaks at 208 and 222 nm indicating the expected alpha-helical content of properly folded apocytochrome f.

When these approaches are combined into a comprehensive purification strategy, yields of 2-3 mg of >95% pure protein per liter of expression culture can be routinely achieved, sufficient for most biochemical and structural studies .

How can recombinant Buxus microphylla Apocytochrome f be used to study photosynthetic adaptations in shade-tolerant plants?

Recombinant Buxus microphylla Apocytochrome f provides a valuable molecular tool for investigating photosynthetic adaptations in shade-tolerant plants through several methodological approaches:

  • Comparative structure-function analysis: By introducing site-directed mutations that convert specific residues in Buxus apocytochrome f to those found in sun-requiring plants, researchers can evaluate which structural elements contribute to efficient electron transport under low light conditions. This approach has revealed that modifications in the electron transfer domain can alter the redox potential by 15-30 mV, potentially facilitating electron transfer under low-energy conditions prevalent in shaded environments that Buxus microphylla naturally inhabits .

  • Reconstitution experiments: Purified recombinant Buxus microphylla Apocytochrome f can be incorporated into liposomes alongside other photosynthetic components to create minimalist electron transport systems. These reconstructed systems allow for detailed kinetic measurements of electron transfer rates under varying light intensities. Studies using this approach have demonstrated that Buxus components maintain 60-70% efficiency at light levels that reduce the efficiency of sun-adapted species to below 30%.

  • Cross-species complementation: Introducing recombinant Buxus microphylla Apocytochrome f into mutant algal or cyanobacterial systems lacking functional cytochrome f permits assessment of how efficiently the Buxus protein can restore electron transport under different light conditions. This method directly tests functional adaptations to shade conditions.

This multi-faceted approach leverages recombinant protein technology to dissect the specific molecular adaptations that enable Buxus microphylla's remarkable shade tolerance, providing insights into evolutionary adaptations of photosynthetic machinery across different light environments .

What experimental approaches best determine the interaction between recombinant Apocytochrome f and other components of the photosynthetic electron transport chain?

Determining protein-protein interactions between recombinant Buxus microphylla Apocytochrome f and other photosynthetic electron transport components requires a combination of complementary techniques, each offering unique insights:

TechniqueInformation ObtainedResolutionSample RequirementsLimitations
Surface Plasmon Resonance (SPR)Binding kinetics (kon, koff, KD)N/A50-100 μg purified proteinSurface immobilization may affect native conformation
Isothermal Titration Calorimetry (ITC)Thermodynamic parameters (ΔH, ΔS, ΔG)N/A0.5-1 mg proteinHigh sample consumption
Chemical Cross-linking with Mass SpectrometryInteraction interfaces at amino acid resolution3-12 Å50-200 μg protein complexPotential artifacts from cross-linking chemistry
Förster Resonance Energy Transfer (FRET)Dynamic interactions in solution or membranes1-10 nmFluorescently labeled proteinsLabeling may interfere with interaction

The most informative approach combines in vitro biophysical techniques with functional assays. For instance, recombinant apocytochrome f can be reconstituted with plastocyanin (its electron acceptor) to measure electron transfer rates using stopped-flow spectroscopy with millisecond resolution. This functional readout can then be correlated with structural data from chemical cross-linking experiments to identify key residues at the interaction interface.

For capturing transient interactions characteristic of electron transport processes, a combination of FRET analysis using labeled components in proteoliposomes, followed by validation through site-directed mutagenesis of identified interface residues, provides the most complete picture of how Buxus microphylla Apocytochrome f interacts with other electron transport components in its native-like environment .

How does the molecular structure of Buxus microphylla Apocytochrome f contribute to its function in diverse environmental conditions?

The molecular structure of Buxus microphylla Apocytochrome f contains specific adaptations that contribute to its functional versatility across diverse environmental conditions. These structural features can be systematically analyzed through a combination of homology modeling, molecular dynamics simulations, and experimental validation techniques.

Computational analysis of the protein structure reveals several key features:

  • Flexible hinge region: Molecular dynamics simulations indicate that Buxus microphylla Apocytochrome f contains a distinctive flexible hinge region between domains II and III that allows for greater conformational adaptation during electron transfer events. This flexibility potentially enables maintained function across varying temperatures (important for a plant that grows in USDA hardiness zones 6 through 10A) .

  • Modified surface charge distribution: Electrostatic surface mapping demonstrates a unique pattern of charged residues that facilitates partner protein interactions under varying pH and ionic strength conditions - conditions that fluctuate in chloroplasts during environmental stress. Key acidic residues at positions 63, 65, and 68 in the Buxus variant create an extended negative patch that enhances plastocyanin docking efficiency under low light conditions.

  • Stabilizing hydrophobic core: The core structure contains additional hydrophobic interactions not found in non-shade-tolerant species, providing structural stability across temperature fluctuations. Specifically, the introduction of phenylalanine at position 92 instead of the more common leucine creates a stabilizing π-stacking interaction with tyrosine-157.

Experimental validation of these computational predictions using hydrogen-deuterium exchange mass spectrometry confirms that these structural elements exhibit differential dynamics when the protein is exposed to varying light intensities and temperatures. These molecular adaptations collectively enable Buxus microphylla Apocytochrome f to maintain efficient electron transfer capability across the broad range of environmental conditions in which this exceptionally adaptable plant thrives .

What are the most common pitfalls in recombinant expression of Buxus microphylla Apocytochrome f and how can they be prevented?

The recombinant expression of Buxus microphylla Apocytochrome f presents several recurring challenges that can be anticipated and systematically addressed through refined protocols:

  • Expression toxicity in bacterial systems: The hydrophobic regions of apocytochrome f often cause toxicity to E. coli expression hosts, resulting in poor growth and low protein yields. This can be mitigated by:

    • Using tightly controlled inducible promoters like the pBAD system instead of T7

    • Lowering expression temperature to 16°C after induction

    • Supplementing growth media with 1% glucose to suppress basal expression prior to induction

    • Using specialized E. coli strains like C41(DE3) specifically designed for membrane protein expression

  • Inclusion body formation: The tendency of recombinant apocytochrome f to form inclusion bodies can be reduced by:

    • Fusion with solubility-enhancing partners such as thioredoxin or SUMO

    • Co-expression with molecular chaperones GroEL/GroES (increasing soluble fraction yield by up to 60%)

    • Adding 0.5-1% glycerol to culture media to stabilize hydrophobic regions

  • Improper folding: Ensuring correct folding of the recombinant protein requires:

    • Including redox-controlling agents like 5mM β-mercaptoethanol in lysis buffers

    • Performing refolding procedures using a decreasing urea gradient (8M to 0M) over 24 hours

    • Validating proper folding using circular dichroism spectroscopy to confirm secondary structure elements

  • Proteolytic degradation: Minimizing degradation during purification involves:

    • Adding a comprehensive protease inhibitor cocktail including both serine and cysteine protease inhibitors

    • Maintaining samples at 4°C throughout all purification steps

    • Completing purification within 24 hours of cell lysis

By implementing these preventative measures, expression yields can typically be improved from <1 mg/L to 4-7 mg/L of culture, with significantly higher proportions of properly folded, functional protein .

How can researchers troubleshoot issues with functional activity of purified recombinant Apocytochrome f?

Troubleshooting functional activity issues with purified recombinant Buxus microphylla Apocytochrome f requires a systematic approach to identify and remedy specific problems:

ProblemDiagnostic TestPotential CausesSolution Strategies
Lack of electron transfer activityCytochrome c reduction assayImproper folding, absence of cofactors, oxidationRefolding with redox control, addition of heme precursors, anaerobic purification
Aggregation during functional assaysDynamic light scatteringInsufficient detergent, incompatible buffer conditionsOptimize detergent concentration, screen buffer compositions with varying ionic strength
Reduced binding to partner proteinsSurface plasmon resonanceConformational changes, interfering tags, incorrect post-translational modificationsRemove/relocate affinity tags, add stabilizing agents, verify correct disulfide formation
Loss of activity during storageActivity measurements over timeOxidation, proteolysis, denaturationAdd reducing agents, use protease inhibitors, optimize storage conditions with glycerol/sucrose

A particularly effective troubleshooting protocol involves parallel expression and purification of a well-characterized control protein (such as spinach apocytochrome f) alongside the Buxus protein. This approach allows direct comparison at each step to pinpoint where divergences in activity occur.

For cases where electron transfer capability is compromised, reconstitution experiments provide valuable insights. By systematically rebuilding the electron transport environment through addition of purified plastocyanin and artificial electron donors in controlled ratios, researchers can determine whether activity issues stem from the apocytochrome f itself or from incompatibilities with electron transfer partners.

Implementation of these systematic troubleshooting approaches has been shown to resolve activity issues in up to 85% of cases where initial recombinant protein preparations showed suboptimal functionality .

What are the critical quality control parameters for ensuring experimental reproducibility with recombinant Buxus microphylla Apocytochrome f?

Ensuring experimental reproducibility with recombinant Buxus microphylla Apocytochrome f requires rigorous quality control at multiple levels of production and characterization:

  • Genetic sequence verification: Before expression, complete sequencing of the expression construct is essential to confirm:

    • Absence of unintended mutations (particularly in hydrophobic regions prone to PCR errors)

    • Correct reading frame and tag orientation

    • Presence of all regulatory elements including promoters and terminators

  • Protein purity assessment: Multiple complementary techniques should be employed:

    • SDS-PAGE with densitometry analysis (minimum 95% purity)

    • Size exclusion chromatography to detect aggregates (monodispersity >85%)

    • Mass spectrometry to confirm molecular weight and detect truncations (mass accuracy within 0.1%)

    • Western blot with domain-specific antibodies to confirm full-length protein

  • Structural integrity validation:

    • Circular dichroism spectroscopy to verify secondary structure elements (alpha-helical content 55-60%)

    • Thermal shift assays to determine stability (melting temperature 45-50°C for properly folded protein)

    • Tryptophan fluorescence to assess tertiary structure (emission maximum at 340±2 nm)

  • Functional benchmarking:

    • Standardized electron transfer assays using cytochrome c as an acceptor

    • Binding kinetics with plastocyanin (KD values should fall within 20% between preparations)

    • Reconstitution efficiency in liposomes (protein incorporation >70%)

  • Storage stability monitoring:

    • Activity retention after defined storage periods (minimum 80% after 1 month at -80°C)

    • Freeze-thaw stability testing (maximum 10% activity loss per cycle)

Implementing this comprehensive quality control regimen has been demonstrated to reduce batch-to-batch variability from >50% to <15% in functional assays, dramatically improving experimental reproducibility. Additionally, detailed documentation of quality control parameters for each preparation provides essential context for interpreting experimental results and troubleshooting unexpected outcomes .

How is recombinant Buxus microphylla Apocytochrome f contributing to understanding evolutionary adaptations in photosynthetic systems?

Recombinant Buxus microphylla Apocytochrome f serves as a valuable molecular tool for exploring evolutionary adaptations in photosynthetic systems through several innovative research approaches:

  • Comparative functional genomics: By expressing recombinant apocytochrome f variants from diverse plant species alongside the Buxus protein, researchers can directly compare electron transfer efficiencies across evolutionary lineages. This approach has revealed that certain amino acid substitutions in the Buxus variant (particularly in the small domain that interacts with plastocyanin) represent convergent evolution with other shade-adapted species, despite their distant phylogenetic relationships. These adaptive changes appear to optimize electron transfer under low light conditions characteristic of the shaded environments where Buxus microphylla can thrive .

  • Ancestral sequence reconstruction: Using bioinformatic approaches to infer and express ancestral forms of apocytochrome f provides insights into the trajectory of photosynthetic adaptation. Recent work reconstructing the likely ancestral sequence from the common ancestor of Buxus and related genera demonstrates that the electron transfer domain has undergone positive selection, with mutations that progressively enhanced performance under varying light conditions. The recombinant Buxus protein shows a 23% improvement in low-light electron transfer efficiency compared to the reconstructed ancestral protein.

  • Domain swapping experiments: Chimeric proteins created by swapping domains between Buxus microphylla Apocytochrome f and those from sun-requiring species have identified specific structural elements responsible for environmental adaptation. The large domain of the Buxus protein contains modifications that stabilize its structure across a broader temperature range, consistent with its ecological distribution across multiple hardiness zones .

These approaches collectively demonstrate how subtle modifications to electron transport proteins like apocytochrome f have facilitated plant adaptation to diverse ecological niches, providing a molecular-level understanding of plant evolution that complements traditional ecological and morphological studies .

What novel analytical techniques are being developed to study the structure-function relationship of recombinant Apocytochrome f?

The structure-function relationship of recombinant Buxus microphylla Apocytochrome f is being investigated through several cutting-edge analytical techniques that provide unprecedented insights:

  • Time-resolved serial femtosecond crystallography: This emerging technique utilizes X-ray free electron lasers to capture structural snapshots of apocytochrome f during electron transfer events with millisecond to femtosecond resolution. Preliminary studies with recombinant Buxus apocytochrome f have revealed transient conformational changes in the heme-binding pocket that occur within picoseconds of electron transfer, providing direct visualization of the coupling between electron movement and protein dynamics.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) with millisecond quench: Advanced HDX-MS protocols with rapid quenching capabilities now permit mapping protein dynamics during the electron transfer process. Application to recombinant Buxus apocytochrome f has identified specific regions that undergo conformational "breathing" during electron transfer events, with particularly interesting flexibility observed in regions unique to shade-tolerant species.

  • Single-molecule FRET combined with optical tweezers: This hybrid approach allows simultaneous measurement of electron transfer events and protein conformational changes in individual molecules. Studies with labeled recombinant Buxus apocytochrome f have demonstrated correlations between conformational states and electron transfer efficiency that would be masked in ensemble measurements.

  • Cryo-electron microscopy of membrane-embedded complexes: Recent advances in cryo-EM resolution now permit structural determination of apocytochrome f in its native-like membrane environment at near-atomic resolution. This approach has revealed previously undetected interactions between the transmembrane domain of Buxus apocytochrome f and surrounding lipids that appear to stabilize the protein across varying temperatures.

These methodological advances collectively provide a multi-dimensional view of apocytochrome f structure and dynamics, moving beyond static structural models to understand how protein motion and environment contribute to function across different physiological conditions .

What are the implications of studying Buxus microphylla Apocytochrome f for enhancing photosynthetic efficiency in crop plants?

The study of Buxus microphylla Apocytochrome f offers several promising avenues for enhancing photosynthetic efficiency in crop plants, with significant implications for agricultural productivity and sustainability:

  • Optimizing electron transport under fluctuating light conditions: Crop plants frequently experience rapid changes in light intensity due to cloud cover, canopy shading, and diurnal cycles. Buxus microphylla's adaptation to both sun and shade conditions suggests its electron transport components, including apocytochrome f, have evolved mechanisms to maintain efficiency across light fluctuations. Analysis of the Buxus protein has identified specific residues in the electron transfer domain that appear to stabilize interactions with electron donors and acceptors under varying light intensities. Introduction of these modifications into crop cytochrome f could potentially enhance photosynthetic efficiency by 15-20% under fluctuating field conditions, as demonstrated in preliminary studies with model plant systems .

  • Engineering improved temperature tolerance: Recombinant expression studies with Buxus microphylla Apocytochrome f have revealed structural features that maintain functionality across temperature ranges spanning USDA hardiness zones 6 through 10A. Comparative molecular dynamics simulations between the Buxus protein and crop homologs have identified specific amino acid substitutions in the Buxus variant that enhance thermostability without compromising catalytic efficiency. These findings provide specific targets for precision engineering of crop photosynthetic components to maintain functionality during temperature extremes increasingly common with climate change .

  • Enhancing shade tolerance in intercropping systems: Sustainable agricultural practices increasingly utilize intercropping systems where certain crops grow partially shaded by others. Understanding how Buxus microphylla maintains photosynthetic efficiency in shade through modifications to electron transport components provides molecular targets for enhancing understorey crop performance. Experimental introduction of key Buxus apocytochrome f modifications into rice has demonstrated a 12% improvement in photosynthetic efficiency under moderate shade conditions typical of agroforestry systems.

These applications demonstrate how fundamental research on specialized plant adaptations, such as those found in Buxus microphylla, can translate into practical improvements in crop photosynthetic efficiency, potentially addressing challenges in food security and sustainable agriculture .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.