Recombinant Buxus microphylla ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Understanding ATP Synthase Subunit a (atpI)

ATP synthase is a rotary enzyme that generates ATP by coupling proton translocation to rotational motion. In chloroplasts, the F₀ sector contains subunit a (atpI), which plays a critical role in proton transport and coupling. Subunit a forms part of the stator, interacting with the c-ring rotor to deprotonate c-subunits during rotation .

Key Features of ATP Synthase Subunit aFunctional Role
Membrane-embedded hairpin structureProton translocation pathway
Interaction with c-ring carboxylatesDeprotonation of c-subunits
Species-specific adaptationspH tolerance in alkaliphiles

Recombinant Production of ATP Synthase Subunits

Recombinant expression systems are widely used to study ATP synthase subunits. For example:

  • Spinach Chloroplast c-subunit (atpH): Recombinant c-subunit was produced in E. coli using maltose-binding protein (MBP) fusion tags, enabling purification and structural analysis .

  • Acorus americanus atpI (Subunit a): A recombinant full-length subunit a (Q4FGF8) was expressed in E. coli with an N-terminal His tag, facilitating biochemical studies .

While Buxus microphylla's subunit a (atpI) is not explicitly mentioned, analogous methods may apply.

Buxus microphylla Biochemical Research

Recombinant Buxus microphylla atpH (Subunit c)Details
SourceBaculovirus
Purity>85% (SDS-PAGE)
Expression Region1-81 amino acids (partial)
FunctionProton translocation in F₀ sector
Storage-20°C/-80°C (with glycerol)

Data sourced from commercial listings .

Functional Significance of Subunit a (atpI)

Subunit a is essential for proton translocation and coupling in ATP synthase. Key findings from other systems:

  • Alkaliphile Adaptations: Lys-180 in subunit a is critical for proton transport at high pH, enabling ATP synthesis in extreme environments .

  • Chaperone Roles: Proteins like AtpI (in bacteria) assist c-ring assembly, though their necessity varies by species .

Gaps and Future Directions

  • Hypothetical Role: Subunit a in Buxus microphylla likely facilitates proton flux, similar to spinach or alkaliphilic systems .

  • Research Challenges: Limited genetic data on Buxus microphylla's plastid genome hinders subunit-specific studies.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a particular tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Buxus microphylla (Littleleaf boxwood) (Japanese boxwood)
Target Names
atpI
Target Protein Sequence
MSVLPCSINTLKVLYDISGVEVGQHFYWQIGGFQVHAQVLITSWVVIAILLGSATIAVRN PQTIPTDGQNFFEYVLEFIRDLSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
This protein serves as a key component of the proton channel. It plays a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is ATP synthase subunit a (atpI) and what is its role in chloroplast function?

ATP synthase subunit a (atpI) is an essential component of the F0 portion of the F1F0-ATP synthase complex in chloroplasts. It forms part of the membrane-embedded proton channel that facilitates proton movement across the thylakoid membrane. This protein contains multiple transmembrane domains that create the pathway for proton translocation, which drives conformational changes in the F1 portion leading to ATP synthesis.

The atpI subunit functions as a stationary component of the ATP synthase complex, interacting with the rotating c-ring to convert the energy of the proton gradient into mechanical rotation. Based on the amino acid sequence of Buxus microphylla atpI, it contains hydrophobic regions characteristic of transmembrane domains that are critical for this function .

What expression systems are most effective for producing recombinant Buxus microphylla atpI?

For producing recombinant Buxus microphylla atpI, E. coli expression systems have proven effective. Based on similar recombinant chloroplast proteins, the following approach is recommended:

  • Vector selection: Vectors with strong promoters (T7) and fusion tags (His-tag) facilitate expression and purification

  • E. coli strains: BL21(DE3) or specialized strains for membrane proteins (C41/C43)

  • Expression conditions: Lower temperatures (16-25°C) after induction to improve folding

  • Protein extraction: Careful membrane solubilization using appropriate detergents

The recombinant protein can be expressed with an N-terminal His-tag, similar to the approach used for Acorus americanus ATP synthase subunit a . This facilitates purification using affinity chromatography while maintaining protein functionality.

What are the optimal storage conditions for purified recombinant atpI protein?

Purified recombinant Buxus microphylla atpI should be stored in conditions that maintain structural integrity and functional activity. Based on available data, the recommended storage conditions are:

  • Buffer composition: Tris-based buffer optimized for the protein with 50% glycerol

  • Temperature: Store at -20°C for regular use, or -80°C for extended storage

  • Aliquoting: Prepare working aliquots to be stored at 4°C for up to one week

  • Freeze-thaw cycles: Repeated freezing and thawing is not recommended as it can compromise protein structure and function

These storage conditions help preserve the native conformation of the membrane protein and prevent aggregation that could impair functional studies.

What molecular mechanisms underlie the proton translocation function of atpI in ATP synthase?

The proton translocation function of atpI involves sophisticated molecular mechanisms that couple proton movement to ATP synthesis. Based on structural and functional studies of ATP synthases:

  • Half-channel architecture: The atpI subunit likely forms two half-channels that connect the thylakoid lumen and stroma to the middle of the membrane where the c-ring rotates

  • Critical residues: Conserved charged and polar amino acids within the transmembrane domains create the proton pathway

  • Conformational coupling: The interaction between atpI and the c-ring creates a dynamic interface that converts proton movement to rotational force

The conserved sequence elements in Buxus microphylla atpI, particularly the transmembrane segments containing the WVVIAILLGSATIAV motif, are likely crucial components of this proton pathway . This is supported by research showing that allosteric cooperativity in ATP synthases requires specific protein-protein interactions for energy transduction .

How do mutations in specific residues of atpI affect the coupling between proton translocation and ATP synthesis?

Mutations in specific residues of atpI can have profound effects on the coupling between proton translocation and ATP synthesis. While specific studies on Buxus microphylla atpI mutations are not available in the provided search results, insights can be drawn from related research:

  • Interface residues: Mutations at the interface between subunits can disrupt the transmission of conformational changes required for ATP synthesis

  • Channel-forming residues: Alterations to residues lining the proton pathway can affect proton conductance

  • Conformational switches: Mutations in regions that undergo conformational changes during catalysis can uncouple proton movement from ATP synthesis

Research on chloroplast ATP synthase has demonstrated that single amino acid changes, such as enlarging the side chain of chloroplast beta subunit residue 63 from Cys to Trp, can block ATP synthesis without significantly affecting ATPase activity . This suggests that even subtle structural changes in critical regions can disrupt the complex conformational coupling necessary for ATP synthesis.

What techniques can be used to study the conformational dynamics of atpI during the catalytic cycle?

Several advanced techniques can be employed to study the conformational dynamics of atpI during ATP synthesis:

  • Site-directed spin labeling (SDSL) with EPR spectroscopy: By introducing spin labels at specific sites in recombinant atpI, researchers can monitor conformational changes during catalysis

  • Fluorescence resonance energy transfer (FRET): Strategic placement of fluorophores can reveal distance changes between domains or subunits

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can identify regions of the protein that undergo conformational changes during catalysis

  • Single-molecule techniques: Approaches such as single-molecule FRET or optical tweezers can track conformational dynamics in real-time

These methods can reveal how atpI structure changes during proton translocation and how these changes are coupled to ATP synthesis. Research has shown that conformational changes in one part of the ATP synthase complex can be transmitted over substantial distances (>40 Å), suggesting long-range allosteric coupling mechanisms .

How does the interaction between atpI and other ATP synthase subunits contribute to enzyme function?

The interaction between atpI and other ATP synthase subunits is crucial for the coordinated function of this multi-subunit enzyme complex:

  • atpI-c ring interface: This critical interface forms the proton translocation pathway and converts proton movement to rotational force

  • Stator connections: Interactions with other stator subunits maintain structural stability during c-ring rotation

  • Conformational transmission: Structural changes in atpI must be transmitted to the F1 catalytic domain through a network of subunit interactions

Research on hybrid ATP synthases has demonstrated that the coupling of nucleotide binding at catalytic sites to transmembrane proton movement involves interactions between subunits via conformational changes . In particular, the amino-terminal domains of alpha and beta subunits have been implicated in this conformational coupling , suggesting that a network of interactions throughout the complex coordinates catalysis.

What purification strategies yield the highest purity and activity for recombinant Buxus microphylla atpI?

Purifying recombinant Buxus microphylla atpI to high purity while maintaining activity requires specialized approaches for membrane proteins:

  • Initial extraction:

    • Cell lysis under gentle conditions to preserve membrane integrity

    • Membrane isolation by ultracentrifugation

    • Solubilization using appropriate detergents (e.g., DDM, LDAO)

  • Affinity purification:

    • For His-tagged atpI: Ni-NTA or IMAC chromatography

    • Carefully optimized wash steps to remove non-specifically bound proteins

    • Elution using an imidazole gradient

  • Secondary purification:

    • Size exclusion chromatography to separate monomeric protein from aggregates

    • Ion exchange chromatography for further purification if needed

  • Quality assessment:

    • SDS-PAGE to verify purity (target >90% purity)

    • Western blotting to confirm protein identity

    • Functional assays to verify activity

The purified protein can be stored in a Tris-based buffer with 50% glycerol to maintain stability during storage at -20°C or -80°C .

How can recombinant atpI be reconstituted into liposomes for functional studies?

Reconstitution of recombinant Buxus microphylla atpI into liposomes provides a controlled system for functional studies:

  • Liposome preparation:

    • Selection of appropriate lipid composition (e.g., DOPC, POPC, or E. coli total lipid extract)

    • Lipid hydration and extrusion to form uniform-sized liposomes

    • Creation of unilamellar vesicles by freeze-thaw cycles and extrusion

  • Protein incorporation:

    • Detergent-mediated incorporation (direct or using destabilized liposomes)

    • Detergent removal by dialysis, Bio-Beads, or Amberlite

    • Optimization of lipid-to-protein ratio for functional reconstitution

  • Verification of incorporation:

    • Density gradient centrifugation to separate protein-containing liposomes

    • Freeze-fracture electron microscopy to visualize incorporated protein

    • Proteoliposome flotation assays

  • Functional reconstitution:

    • Co-reconstitution with other subunits for complete or partial ATP synthase assembly

    • Establishment of proton gradients using pH jumps or K+/valinomycin methods

    • Measurement of proton translocation or ATP synthesis activities

This approach allows investigation of atpI's role in proton translocation in a defined membrane environment, similar to methods used to study other ATP synthase components.

What assays can be used to measure the functional activity of recombinant atpI in vitro?

Several specialized assays can be used to assess the functional activity of recombinant Buxus microphylla atpI:

  • Proton translocation assays:

    • ACMA (9-amino-6-chloro-2-methoxyacridine) fluorescence quenching to monitor proton uptake

    • Pyranine fluorescence for internal pH measurement in proteoliposomes

    • Potentiometric dyes to measure membrane potential generation

  • ATP synthesis measurement (when reconstituted with other ATP synthase subunits):

    • Luciferin/luciferase assay for real-time ATP detection

    • 32P-labeled ADP incorporation into ATP

    • Coupled enzyme assays (hexokinase and glucose-6-phosphate dehydrogenase)

  • Structural integrity assessments:

    • Circular dichroism (CD) spectroscopy to verify secondary structure

    • Intrinsic fluorescence to assess tertiary structure

    • Limited proteolysis to evaluate proper folding

These assays should be performed under various conditions (pH, temperature, ionic strength) to determine optimal functional parameters and to compare the activity of wild-type and mutant forms of the protein.

What site-directed mutagenesis approaches can identify critical residues in Buxus microphylla atpI?

Site-directed mutagenesis provides a powerful approach to identify functionally critical residues in Buxus microphylla atpI:

  • Target selection strategies:

    • Conserved residues identified by sequence alignment between Buxus microphylla and other species

    • Charged residues within transmembrane domains that may participate in proton transfer

    • Residues at potential interaction interfaces with other subunits

  • Mutagenesis methods:

    • PCR-based site-directed mutagenesis using the QuikChange method

    • Gibson Assembly for introducing multiple mutations

    • CRISPR/Cas9 approaches for more complex modifications

  • Mutation types to consider:

    • Conservative substitutions to probe subtleties of function

    • Charge reversals to disrupt electrostatic interactions

    • Introduction of bulky residues at interfaces (similar to the Cys to Trp mutation in beta subunit that blocked ATP synthesis)

    • Alanine scanning of conserved regions

  • Functional analysis of mutants:

    • Expression and purification using protocols optimized for wild-type

    • Comparative analysis of structural integrity and function

    • Reconstitution studies to assess specific aspects of function

This systematic approach can reveal which residues are essential for proton translocation, subunit interaction, or conformational coupling in the ATP synthase complex.

What role might post-translational modifications play in regulating atpI function in chloroplasts?

Post-translational modifications (PTMs) likely play important regulatory roles in modulating atpI function in chloroplasts:

  • Potential PTM types:

    • Phosphorylation of serine, threonine, or tyrosine residues

    • Redox modifications of cysteine residues (note the cysteine at position 6 in Buxus microphylla atpI)

    • Acetylation of lysine residues

    • N-terminal processing during chloroplast import

  • Regulatory functions:

    • Adaptation to changing light conditions

    • Response to stress (oxidative, temperature, pH)

    • Fine-tuning of proton conductance

    • Modulation of subunit interactions

  • Experimental approaches to study PTMs:

    • Mass spectrometry to identify modifications

    • Phospho-specific antibodies

    • Mutagenesis of potential modification sites

    • In vitro modification systems

Research on other ATP synthase subunits has shown that specific residues can be conformationally coupled to distant functional sites , suggesting that modifications at one location could affect function throughout the complex.

How can comparative analysis between Buxus microphylla atpI and other species inform evolutionary adaptation of chloroplast ATP synthase?

Comparative analysis of Buxus microphylla atpI with homologous proteins from other species provides valuable evolutionary insights:

  • Conservation patterns:

    • Highly conserved regions likely represent functionally critical domains

    • Variable regions may reflect species-specific adaptations

  • Adaptation signatures:

    • Comparing sequences from plants adapted to different environments can reveal environmental selective pressures

    • Variations in transmembrane domains may reflect adaptation to different membrane compositions or proton gradient strengths

  • Structural implications:

    • The high similarity between Buxus microphylla and Acorus americanus sequences in certain regions (like QNFFEYVLEFIRDLSKTQIGEEYGP) suggests structural constraints on ATP synthase evolution

    • Differences in other regions may reflect functional specialization

  • Research applications:

    • Design of chimeric proteins to investigate functional domains

    • Identification of species-specific features that could be exploited for selective targeting

    • Understanding how evolutionary changes in sequence affect ATP synthase efficiency

This evolutionary perspective can guide rational design of experiments to probe structure-function relationships in chloroplast ATP synthase.

What implications does atpI research have for understanding bioenergetic adaptations in plants?

Research on Buxus microphylla atpI and related proteins has significant implications for understanding plant bioenergetic adaptations:

  • Photosynthetic efficiency:

    • ATP synthase efficiency directly affects the energy available from photosynthesis

    • Understanding atpI function may reveal mechanisms for optimizing photosynthetic output

  • Stress adaptation:

    • Plants must maintain ATP production under varying environmental conditions

    • atpI structural adaptations may contribute to stress tolerance by maintaining proton translocation under sub-optimal conditions

  • Species-specific adaptations:

    • Variations in atpI sequence between species like Buxus microphylla and others may reflect adaptations to different ecological niches

    • Understanding these adaptations could inform strategies for improving crop plants

  • Biotechnological applications:

    • Engineering atpI to enhance bioenergetic efficiency

    • Development of herbicides targeting species-specific features of atpI

    • Design of synthetic chloroplast ATP synthases with novel properties

By studying the structure-function relationships in atpI across different species, researchers can gain insights into the molecular basis of bioenergetic adaptations that contribute to plant survival and productivity in diverse environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.