Recombinant Buxus microphylla Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Buxus microphylla (Littleleaf boxwood) (Japanese boxwood)
Target Names
cemA
Target Protein Sequence
MAKKKAFTSLPYLASIVFLPWWISLSFNKWLESWVTNWWNTRQSETFLNDIQEKNILEKF IELEELFLLDEMIKEYPETHIQRRIHKETIQLVKMHNESHIHTILHLSTNIICFAILSGY SILGNEGLFILNSWVQEFLYNLSDTIKAFSILLLTDLCIGFHSPHGWELMIGSVYKDFGF AHNDQIISGLVSTFPVILDTILKYWIFRYLNRVSPSLVVIYHSMND
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

How does cemA protein sequence in Buxus microphylla compare to other species in the Buxaceae family?

Comparative analysis of cemA protein sequences across Buxaceae family members reveals highly conserved domains that indicate functional importance. While specific data on Buxus microphylla cemA sequencing is not extensively documented in the provided search results, approaches similar to those used in the Magnolia grandiflora chloroplast genome sequencing can be applied . Researchers typically use multiple sequence alignment tools to identify conserved motifs and functional domains. Conservation patterns often correlate with regions essential for protein function, while variable regions may reflect species-specific adaptations.

What techniques are most effective for isolating native cemA protein from Buxus microphylla chloroplasts?

For effective isolation of native cemA protein from Buxus microphylla chloroplasts, researchers should employ a multi-step approach:

  • Chloroplast isolation using differential centrifugation techniques

  • Envelope membrane fractionation using sucrose gradient centrifugation

  • Protein extraction using appropriate detergents (typically mild non-ionic detergents)

  • Enrichment of membrane proteins with specialized protocols

Research indicates that spatial proteomics approaches, comparing protein occurrence between chloroplast fractions and enriched envelope preparations, can effectively identify and isolate envelope-located proteins like cemA . For maximum yield, fractionate both total intact chloroplasts and enriched envelopes, then perform MS-based protein identification in both fractions. Envelope-located proteins should be present in both fractions but enriched in the envelope preparation.

What expression systems are optimal for producing recombinant Buxus microphylla cemA protein?

The optimal expression systems for recombinant Buxus microphylla cemA protein production depend on research objectives:

Expression SystemAdvantagesLimitationsBest Applications
E. coliHigh yield, rapid growth, cost-effectivePotential improper folding, lack of post-translational modificationsInitial structural studies, antibody production
Yeast (P. pastoris)Eukaryotic post-translational modifications, proper folding of plant proteinsLower yield than E. coli, longer cultivation timeFunctional studies requiring authentic protein structure
Plant-based systemsNative-like folding and modificationsSlower growth, lower yieldStudies requiring authentic protein function
Insect cell systemsHigher eukaryotic modifications, better for membrane proteinsHigher cost, complex methodsAdvanced structural and functional studies

For chloroplast membrane proteins like cemA, insect cell expression systems or plant-based expression systems often provide superior results due to their ability to properly process and fold membrane proteins. When using E. coli systems, fusion tags like MBP or SUMO can improve solubility and folding.

How can researchers effectively analyze the topology of recombinant cemA in artificial membrane systems?

To effectively analyze the topology of recombinant cemA in artificial membrane systems, researchers should implement a multi-faceted approach:

  • Preparation of proteoliposomes with purified recombinant cemA

  • Selective proteolysis assays to determine exposed protein regions

  • Site-directed fluorescent labeling of specific residues

  • Accessibility studies using membrane-impermeable reagents

These approaches can be complemented with computational predictions of transmembrane domains and molecular dynamics simulations to generate a comprehensive topological model. For experimental validation, researchers can use techniques similar to those applied for chloroplast envelope proteins in Arabidopsis thaliana, where multivariable regression models were used to classify envelope localization .

What are the recommended protocols for studying protein-protein interactions involving cemA?

For studying protein-protein interactions involving cemA, researchers should consider these validated approaches:

  • Co-immunoprecipitation (Co-IP) with cemA-specific antibodies

  • Split-ubiquitin yeast two-hybrid assays (specialized for membrane proteins)

  • Bimolecular Fluorescence Complementation (BiFC) in plant protoplasts

  • Proximity labeling techniques (BioID or APEX2)

Each method provides complementary data to build a comprehensive interactome. The selection of technique should align with specific research questions - Co-IP for stable interactions, proximity labeling for transient interactions, and BiFC for in vivo confirmation. Similar approaches have been successfully applied to study other chloroplast envelope proteins in Arabidopsis thaliana, where MS-based proteomics identified interaction networks crucial for chloroplast function .

How does cemA contribute to stress response mechanisms in Buxus microphylla?

The contribution of cemA to stress response mechanisms in Buxus microphylla appears to involve multiple pathways:

  • Regulation of metabolite transport across chloroplast membranes during stress

  • Potential roles in signaling cascades between chloroplast and nucleus

  • Involvement in membrane remodeling under stress conditions

Research on other chloroplast envelope proteins provides insights into potential cemA functions. For example, studies in Arabidopsis thaliana identified several envelope membrane intrinsic or associated proteins exhibiting altered abundance after cold acclimation . Drawing parallels, cemA may play roles similar to the ATP/ADP antiporter (NTT2) or maltose exporter (MEX1), which showed substantial changes in abundance during cold stress . Investigating these potential transport or regulatory functions would provide valuable insights into cemA's role in stress adaptation.

What structural features of cemA are critical for its integration into the chloroplast envelope membrane?

Critical structural features of cemA for chloroplast envelope membrane integration include:

  • Hydrophobic transmembrane domains that anchor the protein in the lipid bilayer

  • Positively charged residues at the stromal side following the "positive-inside rule"

  • Recognition sequences for chloroplast import machinery

  • Specific motifs for lateral integration into the envelope membrane

Although specific data on Buxus microphylla cemA is limited in the search results, research on chloroplast envelope proteins indicates that proper integration depends on both protein structure and interaction with membrane insertion machinery. Computational prediction of transmembrane domains combined with experimental approaches such as selective proteolysis and site-directed mutagenesis can identify these critical structural elements.

How do mutations in the cemA gene affect chloroplast development and photosynthetic efficiency?

Mutations in the cemA gene can significantly impact chloroplast development and photosynthetic efficiency through several mechanisms:

  • Altered envelope membrane integrity affecting metabolite exchange

  • Disrupted protein-protein interactions in functional complexes

  • Impaired signaling between chloroplast and nuclear genomes

  • Compromised stress response capabilities

To investigate these effects, researchers typically employ CRISPR/Cas9-mediated gene editing to create cemA mutants, followed by comprehensive phenotypic analysis including:

Analysis TypeParameters MeasuredExpected Outcomes in cemA Mutants
Chloroplast UltrastructureEnvelope integrity, thylakoid organizationPotential membrane abnormalities, altered thylakoid stacking
Photosynthetic MeasurementsQuantum yield, electron transport rateReduced efficiency, particularly under stress conditions
Metabolite ProfilingCarbon fixation products, membrane lipidsAltered metabolite transport across envelope
Transcriptome AnalysisExpression of photosynthesis-related genesCompensatory expression changes
Stress Response AssaysPerformance under temperature, light stressHypersensitivity to environmental stressors

The importance of envelope proteins in stress adaptation is highlighted by studies showing that mutations in certain envelope transporters significantly affect frost recovery in plants .

How has the cemA gene evolved across different plant lineages, and what does this reveal about its function?

Evolutionary analysis of the cemA gene across plant lineages reveals significant insights about functional conservation and specialization:

The cemA gene is part of the chloroplast genome in most photosynthetic plants, suggesting early evolutionary origin. Comparative genomic approaches, similar to those used for analyzing the chloroplast genome of Magnolia grandiflora, can be applied to trace cemA evolution . Sequence conservation analysis typically shows:

  • Highly conserved functional domains across distant lineages

  • Variable regions that may reflect adaptation to specific ecological niches

  • Conservation patterns correlating with photosynthetic mechanism (C3 vs. C4 plants)

Studies of chloroplast genomes indicate that genes like cemA maintain relatively consistent positions in the genome structure across species, though IR (inverted repeat) regions can show significant variation between species . This conservation suggests fundamental roles in chloroplast function, while lineage-specific variations may indicate adaptive specialization.

What techniques are most effective for comparative proteomic analysis of cemA across different Buxus species?

For effective comparative proteomic analysis of cemA across different Buxus species, researchers should employ:

  • High-resolution mass spectrometry with targeted protein enrichment

  • Data-independent acquisition (DIA) methods for quantitative comparison

  • Peptide fingerprinting for species-specific cemA variants

  • Multi-dimensional protein identification technology (MudPIT)

The spatial proteomics approach used for envelope membrane protein profiling in Arabidopsis can be adapted for Buxus species . This involves fractionating organelles and identifying protein distribution across differentially enriched subfractions. By comparing protein occurrence in chloroplast fractions with envelope fractions from different Buxus species, researchers can identify species-specific variations in cemA localization and abundance.

Consider creating a comprehensive database of Buxus chloroplast proteins to facilitate cross-species identification and functional annotation.

How do post-translational modifications of cemA differ between Buxus microphylla and other plant species?

Post-translational modifications (PTMs) of cemA can vary significantly between Buxus microphylla and other plant species, reflecting different regulatory mechanisms and environmental adaptations. To investigate these differences:

  • Employ phosphoproteomics to map phosphorylation sites using TiO₂ enrichment

  • Analyze acetylation patterns using immunoprecipitation with anti-acetyl-lysine antibodies

  • Investigate other PTMs including methylation, ubiquitination, and glycosylation

  • Compare PTM patterns under various stress conditions

These analyses can reveal regulatory mechanisms specific to Buxus microphylla cemA function. While direct studies on cemA PTMs are not detailed in the search results, research on chloroplast envelope proteins indicates that post-translational modifications significantly impact protein function, particularly under stress conditions like cold acclimation .

What are the primary challenges in expressing and purifying functional recombinant cemA protein?

The primary challenges in expressing and purifying functional recombinant cemA protein include:

  • Maintaining proper membrane protein folding during expression

  • Achieving sufficient yield of functional protein

  • Developing effective solubilization protocols without disrupting structure

  • Reconstituting purified protein in artificial membrane systems

To address these challenges, researchers can:

ChallengeSolution ApproachKey Considerations
Protein misfoldingUse specialized expression hosts (C41/C43 E. coli strains, insect cells)Lower expression temperature, specialized chaperones
Low expression yieldOptimize codon usage, use strong but controlled promotersBalance between expression level and toxicity
Protein aggregationScreen multiple detergents for solubilizationTest detergent series from mild (DDM, LMNG) to stronger (SDS)
Purification difficultiesImplement tandem affinity tagsConsider removable tags (TEV cleavage site)
Functional assessmentDevelop liposome reconstitution protocolsMatch lipid composition to chloroplast envelope

These approaches must be optimized specifically for cemA, as each membrane protein poses unique challenges.

How can researchers overcome difficulties in generating specific antibodies against cemA?

Generating specific antibodies against cemA presents several challenges due to its membrane-embedded nature and potential conservation across species. To overcome these difficulties:

  • Design immunogenic peptides from predicted extramembrane regions

  • Use multiple peptide antigens targeting different cemA regions

  • Implement rigorous screening for cross-reactivity with other membrane proteins

  • Consider phage display antibody technology for difficult epitopes

The peptide design should target unique regions of Buxus microphylla cemA that differentiate it from orthologs in other species. For validation, use western blotting against both recombinant protein and native protein extracts, with appropriate controls including pre-immune serum and cemA-depleted samples.

What are the best approaches for studying cemA trafficking and integration into the chloroplast envelope?

To effectively study cemA trafficking and integration into the chloroplast envelope, researchers should employ:

  • Fluorescent protein fusions with cemA for live-cell imaging

  • In vitro chloroplast import assays with radiolabeled precursors

  • Site-specific crosslinking to identify interaction with translocon components

  • Pulse-chase experiments to track the kinetics of integration

For in vitro import assays, isolated intact chloroplasts are essential. The protocol for chloroplast isolation should be optimized for Buxus microphylla, potentially adapting methods similar to those used for Arabidopsis thaliana . The spatial distribution of cemA during import can be monitored by fractionating chloroplasts after import and analyzing the distribution of labeled protein.

For live-cell imaging, transient expression in protoplasts can provide insights into the targeting and integration process, while stable transformation allows for long-term studies of protein dynamics.

How might understanding cemA function contribute to improving plant stress tolerance?

Understanding cemA function could significantly contribute to improving plant stress tolerance through several potential applications:

  • Genetic engineering of cemA to enhance metabolite transport efficiency

  • Modification of cemA regulation to improve response to environmental stressors

  • Utilizing cemA variants from stress-tolerant species in sensitive crops

  • Developing small molecules that target cemA-dependent pathways

Research on other chloroplast envelope proteins provides a framework for understanding how cemA might influence stress tolerance. Studies in Arabidopsis thaliana identified several envelope proteins exhibiting altered abundance after cold acclimation, including transporters like NTT2 (ATP/ADP antiporter) and MEX1 (maltose exporter) . If cemA functions similarly in regulating metabolite transport across the envelope, it could be a critical target for enhancing stress adaptation.

Analysis of loss-of-function mutants for envelope transporters has shown significant effects on frost recovery in plants , suggesting that optimizing cemA function could similarly improve tolerance to temperature stress.

What novel analytical techniques are emerging for studying membrane protein dynamics that could be applied to cemA research?

Several emerging analytical techniques for studying membrane protein dynamics show promise for cemA research:

  • Cryo-electron microscopy (Cryo-EM) for high-resolution structural analysis

  • Single-molecule tracking using photoactivatable fluorescent proteins

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) for conformational dynamics

  • In-cell NMR for studying protein behavior in native environments

These advanced approaches allow researchers to move beyond static structural models to understand the dynamic behavior of cemA in response to changing cellular conditions. For example, HDX-MS can reveal conformational changes in cemA in response to binding partners or environmental stressors, while single-molecule tracking can elucidate the lateral mobility and clustering behavior of cemA in the membrane.

How can systems biology approaches integrate cemA function into broader models of chloroplast signaling networks?

Systems biology approaches can effectively integrate cemA function into broader models of chloroplast signaling networks through:

  • Multi-omics data integration (transcriptomics, proteomics, metabolomics)

  • Network modeling of protein-protein interactions centered on cemA

  • Flux balance analysis to quantify metabolite transport roles

  • Machine learning approaches to predict cemA functions from diverse datasets

To implement these approaches, researchers should:

  • Generate comprehensive interaction maps using techniques like proximity labeling

  • Perform time-course experiments to capture dynamic changes in response to stimuli

  • Create mathematical models that incorporate cemA function in chloroplast homeostasis

  • Validate model predictions with targeted experimental approaches

The spatial proteomics approach used for envelope membrane protein profiling provides a foundation for integrating cemA into broader functional networks . By comparing protein abundances across different fractions and conditions, researchers can identify functional relationships between cemA and other chloroplast components.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.