Recombinant Buxus microphylla NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify it in your order for preferential development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Buxus microphylla (Littleleaf boxwood) (Japanese boxwood)
Target Names
ndhC
Target Protein Sequence
MFLLHEYDIFWAFLIISSVIPILAFLISGVLAPISKGPEKLSSYESGIEPMGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEALIFVLILIVGSVYAWRKGALEWS
Uniprot No.

Target Background

Function

NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone to quinones within the photosynthetic and potentially chloroplast respiratory chains, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this species, plastoquinone is the presumed immediate electron acceptor. The enzyme couples this redox reaction to proton translocation, conserving the redox energy as a proton gradient.

Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of NAD(P)H-quinone oxidoreductase subunit 3 in Buxus microphylla?

NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) in Buxus microphylla is a chloroplastic enzyme component involved in electron transfer from NAD(P)H to plastoquinone. The protein typically consists of 120 amino acids and functions as part of a larger complex that includes FMN and iron-sulfur centers . This enzyme participates in the photosynthetic electron transport chain and possibly in chloroplast respiratory processes. The protein is encoded by the ndhC gene in the chloroplast genome and represents one subunit of the multi-subunit NAD(P)H dehydrogenase complex .

The functionality of this enzyme relies on its ability to utilize both NADH and NADPH as electron donors, making it relatively unique among oxidoreductases . The protein's core structure includes transmembrane domains that anchor it within the chloroplast inner membrane, where it participates in proton translocation coupled to electron transfer .

How does the recombinant form of this enzyme differ from its native counterpart?

The recombinant form of Buxus microphylla NAD(P)H-quinone oxidoreductase subunit 3 is typically expressed in heterologous systems like E. coli with specific modifications:

  • Expression tags: The recombinant version often contains an N-terminal histidine tag to facilitate purification

  • Sequence modifications: May include optimization of codons for expression host without changing the amino acid sequence

  • Post-translational modifications: The recombinant protein expressed in prokaryotic systems lacks plant-specific post-translational modifications that might be present in the native enzyme

  • Solubility adjustments: Expression conditions are optimized to enhance protein solubility while maintaining structural integrity

The activity of the recombinant enzyme may differ from the native form due to these modifications, although core catalytic properties are generally preserved. Researchers should validate enzyme kinetics through comparative assays when transitioning from native to recombinant systems .

What are the optimal conditions for expressing recombinant Buxus microphylla ndhC protein in E. coli systems?

Optimal expression of recombinant Buxus microphylla ndhC protein in E. coli requires precise control of multiple parameters:

ParameterRecommended ConditionsNotes
Expression strainBL21(DE3) or RosettaRosetta strains provide additional tRNAs for rare codons
Growth temperature18-22°C post-inductionLower temperatures reduce inclusion body formation
Induction0.1-0.5 mM IPTGLower IPTG concentrations often yield better soluble protein
Media compositionLB with 0.5% glucoseGlucose helps suppress basal expression
Growth phaseInduce at OD600 of 0.6-0.8Mid-log phase provides optimal balance
Expression time16-18 hoursLonger times at lower temperatures improve folding

Membrane proteins like ndhC often require specialized approaches for proper folding. Consider addition of membrane-mimicking detergents (0.1-0.5% n-dodecyl-β-D-maltoside) during cell lysis to solubilize the protein. The purification protocol should include immobilized metal affinity chromatography (IMAC) using the His-tag, followed by size exclusion chromatography to ensure homogeneity .

What methods are most effective for assessing the enzymatic activity of recombinant ndhC?

Enzymatic activity assessment for recombinant ndhC requires specialized assays focusing on electron transfer capability:

  • Spectrophotometric quinone reduction assay: Monitor decrease in absorbance at 340 nm as NAD(P)H is oxidized in the presence of quinone substrates. The reaction buffer typically contains 50 mM Tris-HCl (pH 7.5), 100 mM NaCl, and 100-200 μM NAD(P)H with 50-100 μM quinone substrates .

  • Ferric chelate reduction assay: Similar to the method described for chloroplast ferric chelate oxidoreductase, monitor the formation of Fe(II)-bathophenanthroline disulfonate complex spectrophotometrically at 535 nm .

  • Artificial electron acceptor assays: Using dichlorophenolindophenol (DCPIP) as an electron acceptor and measuring the decrease in absorbance at 600 nm.

The reaction kinetics should be analyzed using Michaelis-Menten models to determine KM and Vmax values. For ndhC specifically, biphasic kinetics may be observed, indicating multiple binding sites or conformational changes during catalysis . Activity measurements should be performed both with NADH and NADPH to determine cofactor preference, which typically shows 2.5 times higher activity with NADPH than NADH for chloroplastic enzymes .

How can researchers distinguish between the activities of different NAD(P)H-quinone oxidoreductase subunits in experimental settings?

Distinguishing between activities of different NAD(P)H-quinone oxidoreductase subunits requires a multi-faceted approach:

  • Recombinant expression of individual subunits: Express each subunit separately with appropriate tags and characterize their individual properties .

  • Substrate specificity profiling: Different subunits may show preferences for specific quinone substrates:

    • Short-chain ubiquinones (CoQ1, CoQ2)

    • Benzoquinone derivatives

    • Duroquinone

    • Juglone

    Measure reaction rates with each substrate to develop a specificity fingerprint .

  • Inhibitor sensitivity: Test sensitivity to inhibitors like dicoumarol, which is a potent inhibitor of NQO1 with Ki values around 50 pM. Different subunits show varying degrees of inhibition .

  • Immunological approaches: Develop subunit-specific antibodies like those available for NdhB and NdhH to identify and quantify specific subunits in complex samples .

  • Mass spectrometry characterization: Use LC-MS/MS with multiple reaction monitoring (MRM) to quantify specific peptides unique to each subunit.

When working with chloroplastic NAD(P)H-quinone oxidoreductases, isolate chloroplast inner envelope vesicles through gradient ultracentrifugation to obtain enriched fractions for subunit-specific activity measurements .

How does Buxus microphylla NAD(P)H-quinone oxidoreductase subunit 3 compare with similar enzymes in other plant species?

Comparative analysis of Buxus microphylla ndhC with other plant species reveals several key insights:

SpeciesAmino Acid LengthSequence Identity (%)Functional DifferencesReference
Buxus microphylla120100 (reference)-
Mesostigma viride120~75-80Similar core function, divergent in terminal regions
Arabidopsis thaliana119~85Similar function, used as model for antibody development
Nymphaea alba120~80Similar membrane topology
Solanum lycopersicum120~80Comparable electron transfer properties

The ndhC protein is generally well-conserved across plant species, reflecting its essential role in photosynthetic electron transport. Variations typically occur in terminal regions while preserving the core transmembrane domains. Phylogenetic analysis suggests that the evolution of ndhC correlates with adaptations to different photosynthetic requirements and environmental conditions .

Functional studies indicate that while the core electron transfer mechanism is conserved, species-specific variations in kinetic parameters and regulatory mechanisms may exist. These differences likely reflect adaptations to specific environmental conditions and photosynthetic requirements of each species .

What are the evolutionary implications of structural differences in chloroplastic NAD(P)H-quinone oxidoreductase across different plant taxa?

The evolutionary analysis of chloroplastic NAD(P)H-quinone oxidoreductase structures across plant taxa reveals several significant patterns:

  • Structural conservation with functional divergence: The core structure of ndhC and related subunits is highly conserved, but subtle variations in key residues lead to functional specialization across different plant lineages. These adaptations reflect evolutionary responses to varying light conditions, stress factors, and photosynthetic requirements .

  • Loss and reacquisition: Some plant lineages have lost certain ndh genes during evolution but developed alternative mechanisms for similar functions. For example, some gymnosperms have lost functional ndh genes but compensate through enhanced alternative electron transport pathways.

  • Co-evolution with photosystems: The evolution of NAD(P)H-quinone oxidoreductase subunits appears coordinated with changes in photosystem structure and function. Recent structural studies of PSI-NDH supercomplexes demonstrate specific interaction sites that have co-evolved to maintain efficient energy transfer and regulation .

  • Environmental adaptation signatures: Comparative analysis of ndhC sequences from plants adapted to different environments (shade vs. high light, drought-tolerant vs. water-abundant habitats) reveals selection pressures on specific residues that modify electron transport efficiency and regulation.

The presence of NAD(P)H-quinone oxidoreductase in both chloroplasts and bacteria (as demonstrated by the "nitroreductase" group of enzymes) suggests an ancient origin with subsequent divergent evolution . These evolutionary patterns provide insights into potential engineering targets for enhancing photosynthetic efficiency in crop plants.

How can recombinant Buxus microphylla ndhC be utilized in enzyme engineering for enhanced catalytic efficiency?

Recombinant Buxus microphylla ndhC presents several opportunities for enzyme engineering to enhance catalytic efficiency:

  • Rational design approaches: Using computational tools to identify catalytic residues for site-directed mutagenesis. This approach has been successful with other oxidoreductases, as demonstrated in recent design and evolution studies of enzymes .

  • Directed evolution strategies: Implementing iterative rounds of mutation and selection to improve specific properties:

    • Combinatorial Active-Site Saturation Test (CAST) targeting residues lining the substrate binding pocket

    • Iterative Saturation Mutagenesis (ISM) to progressively optimize activity

    • Focused Rational Iterative Site-specific Mutagenesis (FRISM) as a fusion of rational design and directed evolution

  • Domain swapping: Creating chimeric enzymes by combining domains from ndhC with those from related enzymes with desirable properties, such as altered substrate specificity or improved stability.

  • Cofactor engineering: Modifying binding sites to alter cofactor preference between NADH and NADPH, potentially enhancing electron transfer rates.

  • Stability enhancement: Introducing disulfide bridges or salt bridges to improve thermal stability without compromising catalytic activity.

Recent advances in computational enzyme design tools, particularly those based on deep learning, offer promising approaches for redesigning ndhC with enhanced properties. These methods can reliably generate stable de novo proteins with novel backbone geometries that serve as idealized templates for hosting catalytic sites .

What are the potential applications of studying ndhC in understanding stress response mechanisms in plants?

The study of ndhC offers valuable insights into plant stress response mechanisms with several research applications:

  • Drought stress adaptation: Under water-limited conditions, the NAD(P)H dehydrogenase complex containing ndhC plays a critical role in maintaining photosynthetic efficiency through enhanced cyclic electron flow. Research shows that plants with higher ndhC activity often demonstrate improved drought tolerance .

  • High light stress response: The complex contributes to photoprotection by facilitating alternative electron flow pathways that help dissipate excess excitation energy. Comparative studies between sun and shade plants reveal differential regulation of ndhC expression and activity.

  • Temperature stress management: NAD(P)H dehydrogenase activity is modulated during temperature stress, with evidence suggesting that the complex helps maintain photosynthetic electron transport under both heat and cold stress conditions.

  • Redox signaling pathways: The ndhC-containing complex influences cellular redox status, potentially triggering signaling cascades that activate stress response mechanisms:

    • Regulation of reactive oxygen species (ROS) homeostasis

    • Activation of stress-responsive transcription factors

    • Modulation of stress hormone signaling networks

  • Metabolic adaptations: Changes in ndhC activity influence the NAD(P)H/NAD(P)+ ratio, affecting numerous metabolic pathways involved in stress responses, including antioxidant systems and osmolyte production.

Research methodologies for investigating these stress responses typically include comparative transcriptomics, proteomics, and metabolomics analyses of wild-type plants versus those with altered ndhC expression under various stress conditions .

How might the characterization of Buxus microphylla ndhC contribute to the development of biocatalysts for sustainable chemistry applications?

The characterization of Buxus microphylla ndhC offers promising avenues for developing novel biocatalysts in sustainable chemistry:

  • Quinone biotransformation: The enzyme's ability to reduce various quinones can be harnessed for eco-friendly synthesis of hydroquinones, which are valuable intermediates in pharmaceutical and fine chemical production .

  • Redox biocatalysis: The NAD(P)H-dependent reduction mechanism can be leveraged for stereoselective reduction of prochiral compounds, potentially replacing traditional chemical reducing agents with enzymatic processes that operate under mild conditions .

  • Integration into cascade reactions: The enzyme can be incorporated into multi-enzyme cascades for complex biotransformations, enabling one-pot synthesis routes that minimize waste and maximize atom economy.

  • Environmental detoxification: Similar to human NQO1's role in detoxifying quinones and preventing formation of reactive semiquinones, engineered versions of ndhC could potentially detoxify quinone-containing environmental pollutants .

  • Bioelectrochemical applications: The electron transfer properties of ndhC make it a candidate for development of bioelectrochemical systems, including biosensors and biofuel cells.

These applications align with the goals of the International Center for Enzyme Design (ICED), which aims to deliver customized biocatalysts for sustainable production of chemicals and biologics . By applying AI-powered protein design tools to enzymes like ndhC, researchers can develop new biocatalytic processes that operate with high efficiency and selectivity under environmentally friendly conditions .

What are the common challenges in purifying active recombinant ndhC, and how can they be addressed?

Purification of active recombinant ndhC presents several challenges that require specific strategies:

ChallengeCauseSolution StrategyReference
Poor solubilityMembrane protein characterUse mild detergents (0.5-1% n-dodecyl-β-D-maltoside); express as fusion with solubility enhancers (MBP, SUMO)
Low expression levelsCodon bias, toxicityOptimize codons; use lower growth temperatures (16-18°C); employ tightly regulated expression systems
Cofactor lossDissociation during purificationSupplement buffers with low concentrations of FAD (5-10 μM) during purification
AggregationHydrophobic interactionsInclude glycerol (10-20%) and reducing agents (1-5 mM DTT) in all buffers
Proteolytic degradationExposure to proteasesAdd protease inhibitor cocktails; minimize purification time; maintain low temperatures (4°C)
Loss of activityOxidation of critical thiolsInclude reducing agents; perform purification under nitrogen atmosphere

A particularly effective purification protocol involves:

  • Solubilization of membrane fractions using detergent mixtures optimized for chloroplastic proteins

  • IMAC purification under reducing conditions with step gradients of imidazole

  • Size exclusion chromatography to separate monomeric from aggregated forms

  • Activity measurements throughout purification to track specific activity

Storage of purified enzyme typically requires 50% glycerol and -80°C temperatures to maintain activity. Some researchers report successful lyophilization with trehalose (6%) as a stabilizing agent for longer-term storage .

How can researchers overcome experimental difficulties in assessing ndhC function within complex photosynthetic systems?

Studying ndhC function within complex photosynthetic systems requires specialized approaches to overcome experimental challenges:

  • Isolation of intact chloroplasts and subfractions:

    • Use Percoll gradient centrifugation for intact chloroplasts

    • Employ controlled osmotic shock to separate envelope fractions

    • Utilize digitonin solubilization (0.5-1%) for gentle membrane protein extraction

    • Confirm fraction purity with western blotting against marker proteins (RBCL for stroma, LHCB1 for thylakoids, Tic40 for inner envelope)

  • Functional redundancy assessment:

    • Employ specific inhibitors of different electron transport pathways

    • Use mutant plants with targeted disruptions in related components

    • Implement in vitro reconstitution with defined components to isolate specific activities

  • Real-time activity measurements:

    • Develop fluorescence-based assays using NAD(P)H autofluorescence

    • Employ oxygen electrode measurements to monitor whole-chain electron transport

    • Use artificial electron acceptors with distinct spectral properties to differentiate parallel electron flows

  • Protein-protein interaction analysis:

    • Implement blue native PAGE to preserve native complexes

    • Apply chemical cross-linking combined with mass spectrometry

    • Utilize split-reporter systems for in vivo interaction confirmation

  • Genetic complementation strategies:

    • Develop chloroplast transformation systems for precise genetic manipulation

    • Use inducible expression systems to control timing of complementation

    • Implement site-directed mutagenesis to create specific functional variants

These approaches have been successfully employed to study PSI-NDH supercomplexes and their functional significance in various plant species , providing models for similar investigations of Buxus microphylla ndhC.

What are the most promising avenues for further research on Buxus microphylla NAD(P)H-quinone oxidoreductase subunit 3?

Several high-potential research directions for Buxus microphylla ndhC warrant investigation:

  • Structural biology approaches: Determine high-resolution structures of Buxus ndhC alone and within the context of the complete NDH complex using cryo-electron microscopy techniques. This would provide critical insights into:

    • Substrate binding mechanisms

    • Electron transfer pathways

    • Protein-protein interaction interfaces

    • Regulatory site identification

  • Systems biology integration: Explore how ndhC activity coordinates with other chloroplast processes through:

    • Multi-omics approaches (transcriptomics, proteomics, metabolomics)

    • Flux analysis of electron transport under varying conditions

    • Mathematical modeling of photosynthetic electron transport networks

  • Comparative biochemistry across Buxus species: Investigate variations in ndhC properties among different Buxus species adapted to diverse environmental conditions, potentially revealing natural optimization strategies.

  • Synthetic biology applications: Develop chimeric enzymes combining desirable properties from different species' ndhC proteins, potentially creating enhanced variants for biotechnological applications.

  • Phytochemical interaction studies: Examine how Buxus-specific secondary metabolites (such as those identified in Buxus papillosa ) might interact with and regulate ndhC activity, potentially revealing novel regulatory mechanisms.

These research directions align with emerging trends in enzyme research, including the integration of computational design with advanced protein engineering approaches as highlighted in recent literature on building enzymes through design and evolution .

How might advances in AI-powered protein design tools impact future research on NAD(P)H-quinone oxidoreductases?

AI-powered protein design tools are poised to revolutionize research on NAD(P)H-quinone oxidoreductases in several significant ways:

  • Structure prediction and functional analysis: Deep learning models can accurately predict protein structures from sequence data, enabling researchers to generate reliable structural models of ndhC variants without crystallographic data. These models can inform structure-function relationship studies and guide experimental design .

  • Rational design of improved variants: AI tools can identify optimal amino acid substitutions to enhance specific properties:

    • Increased catalytic efficiency (kcat/KM)

    • Altered substrate specificity

    • Enhanced thermostability

    • Improved solubility

    • Optimized cofactor binding

  • De novo enzyme design: Creating entirely new oxidoreductases with tailored catalytic properties by:

    • Designing idealized protein scaffolds optimized for electron transfer

    • Engineering precise geometries of catalytic residues

    • Incorporating unnatural amino acids to expand catalytic repertoire

    • Generating proteins with shapes beyond those found in nature

  • Predictive metabolic engineering: AI models can predict how modifications to ndhC and related enzymes will impact cellular metabolism, allowing researchers to optimize electron flow in photosynthetic systems.

  • Accelerated experimental design: Machine learning algorithms can design optimal directed evolution strategies, significantly reducing the experimental burden by suggesting minimal libraries with maximal coverage of functional space .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.