Recombinant Buxus microphylla NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

The Recombinant Buxus microphylla NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic, is a recombinant protein derived from the Japanese boxwood (Buxus microphylla). It belongs to the NAD(P)H-quinone oxidoreductase (NDH) complex in chloroplasts, a multi-subunit enzyme critical for electron transport and cyclic electron flow in photosynthesis . This subunit, denoted as ndhE in genomic nomenclature, plays a structural or regulatory role in the NDH complex, which facilitates proton translocation and interacts with photosystem I (PSI) .

2.1. Amino Acid Sequence and Recombinant Production

The protein spans 101 amino acids (1–101 residues) and includes an N-terminal His-tag for purification . Its sequence aligns with chloroplastic NDH subunits, sharing conserved motifs for membrane integration and quinone interaction .

Table 2: Comparison of Chloroplastic NDH Subunits

SubunitOrganismMolecular Weight (kDa)Role in NDH Complex
4LHordeum vulgare11.2Structural stabilization
FH. vulgare87.6Core subunit, cofactor binding
6H. vulgare19.6Quinone interaction
HH. vulgare44.6Proton translocation

4.1. Recombinant Production

The protein is commercially available as a recombinant His-tagged variant, purified for biochemical assays . Key applications include:

  • ELISA Development: Used as an antigen in immunological kits for detecting anti-NDH antibodies .

  • Structural Studies: Serves as a model for NDH complex assembly and function .

Product Specs

Form
Lyophilized powder
Please note that we prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Buxus microphylla (Littleleaf boxwood) (Japanese boxwood)
Target Names
ndhE
Target Protein Sequence
MMLEHVLVLGAYLFSIGIYGLITSRNMVRALMCLELILNAVNINLVTFSDFFDSRQLKGD ILSIFVIAIAAAEAAIGLAIVSSIYRNRKSTRINQSNLLNK
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and potentially in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is thought to be plastoquinone. NDH couples the redox reaction to proton translocation, thereby conserving redox energy in a proton gradient.
Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of Buxus microphylla NAD(P)H-quinone oxidoreductase subunit 4L?

Buxus microphylla NAD(P)H-quinone oxidoreductase subunit 4L (UniProt accession: A6MM89) is a 101-amino acid protein localized to the chloroplast. The protein is part of the NDH complex that shuttles electrons from NAD(P)H to plastoquinone via FMN and iron-sulfur centers . The protein contains transmembrane domains typical of membrane-embedded subunits of respiratory chain complexes. Structurally, it resembles other plastid NDH subunits with conserved topology but exhibits species-specific variations in the active site that influence substrate specificity. The protein functions as part of a multi-subunit complex, where each asymmetric unit contains multiple molecules stabilized by intermolecular interactions, similar to what has been observed in other quinone oxidoreductases .

What is the precise catalytic function of NDH complexes containing this subunit?

The NDH complex catalyzes the reaction: a plastoquinone + (n+1) H+(in) + NADH = a plastoquinol + n H+(out) + NAD+ . Alternatively, it can use NADPH as a substrate: a plastoquinone + (n+1) H+(in) + NADPH = a plastoquinol + n H+(out) + NADP+ . This reaction couples electron transfer to proton translocation across the thylakoid membrane, conserving redox energy in a proton gradient. The complex functions in both the photosynthetic electron transport chain and possibly in a chloroplast respiratory chain . Unlike simpler quinone oxidoreductases that may produce reactive semiquinones, chloroplastic NDH complexes perform complete two-electron reductions of quinones, preventing the formation of reactive oxygen species that could damage cellular components .

How does Buxus microphylla NDH complex differ from other plant species?

While the core NDH complex structure is conserved across plant species, there are notable differences in substrate specificity and cofactor binding. For example, sequence alignment of QORs from various oomycetes including Phytophthora palmivora, Saprolegnia parasitica, and Aphanomyces astaci shows that while they contain conserved Tyr residues around the NADPH pocket, Arg is replaced with Gly or Ser in some species . In Buxus microphylla specifically, the protein sequence and structural features suggest particular adaptations for interaction with plastoquinone within the chloroplast environment. Unlike some bacterial quinone oxidoreductases where substrate access is restricted by residues like L50, A51, and W243 (as in T. thermophilus HB8 QOR), plant NDH complexes typically have a more accessible substrate-binding pocket allowing for interaction with larger quinone substrates .

What evolutionary patterns are observed in NAD(P)H-quinone oxidoreductase across plant species?

Phylogenetic analysis based on chloroplast genome sequences places Buxus microphylla among early-diverging angiosperms . Comparison of NAD(P)H-quinone oxidoreductase sequences across species reveals conserved functional domains while showing evolutionary adaptations. For instance, studies of ζ-crystallin-like QORs from Saccharomyces cerevisiae indicate that a single-residue change from Arg in lower organisms to Gly in vertebrates may have resulted in elevation of enzymatic activity throughout evolution . Chloroplastic NDH complexes specifically evolved to function in cyclic electron transport around photosystem I, a process crucial for balancing the ATP/NADPH ratio during photosynthesis . The protein subunits show higher conservation in regions involved in electron transfer and cofactor binding, while membrane-spanning domains exhibit greater variability.

What approaches are most effective for expressing and purifying active recombinant forms of this protein?

Successful expression of active recombinant Buxus microphylla NAD(P)H-quinone oxidoreductase subunit 4L requires addressing several challenges:

  • Expression System Selection: Bacterial expression systems (E. coli) may be suitable for initial studies, but lack chloroplast-specific post-translational modifications. Plant-based expression systems may yield more natively-folded protein.

  • Purification Strategy: A multi-step approach is typically required:

    • Initial capture using affinity chromatography (His-tag or specific antibody-based)

    • Intermediate purification using ion-exchange chromatography

    • Polishing using size-exclusion chromatography to separate functional oligomeric forms

  • Stability Considerations: The protein should be maintained in appropriate buffer conditions with glycerol (typically 50%) and stored at -20°C to -80°C to maintain long-term stability . Repeated freeze-thaw cycles should be avoided.

  • Activity Verification: Enzymatic activity assays using NAD(P)H and plastoquinone or suitable quinone analogs are essential to verify functional integrity of the purified protein.

Previous studies with similar proteins have shown that preserving the native oligomeric state (typically tetrameric for many QORs) is critical for maintaining catalytic activity . The protein may require reconstitution with FAD cofactor during or after purification to ensure full activity.

How can computational approaches inform understanding of substrate binding and electron transfer?

Computational approaches have proven valuable for elucidating mechanistic details of NAD(P)H-quinone oxidoreductases:

  • Molecular Docking: Studies with other QORs have used docking to identify potential quinone-binding channels. Similar approaches can be applied to the Buxus microphylla protein to predict interactions with plastoquinone and other substrates .

  • Molecular Dynamics Simulations: MD simulations can reveal conformational changes during catalysis, particularly how NADPH binding influences substrate access and binding. Previous work with PcQOR demonstrated that NADPH binding causes conformational changes that affect substrate recognition .

  • Quantum Mechanics/Molecular Mechanics (QM/MM): These methods are particularly valuable for modeling electron transfer reactions. For NDH complexes, QM/MM can help elucidate the precise mechanism of hydride transfer from NAD(P)H to the quinone substrate.

  • Homology Modeling: Where crystal structures are unavailable, models based on homologous proteins can provide structural insights. For Buxus microphylla NAD(P)H-quinone oxidoreductase, models might be built using structures like the PcQOR-NADPH complex resolved at 2.4 Å .

Computational simulation combined with site-directed mutagenesis and enzymatic activity analysis has previously defined potential quinone-binding sites in similar enzymes and can inform similar studies with the Buxus microphylla protein .

What is the impact of conserved residues on catalytic activity and how can they be experimentally verified?

Critical residues for NAD(P)H-quinone oxidoreductase function can be identified through sequence alignment and structural analysis, then verified through site-directed mutagenesis:

Functional RegionKey Residues (based on homologous proteins)Proposed FunctionExperimental Approach
NADPH bindingConserved Tyr residues, Arg/Gly/Ser variationsStabilization of adenine ringMutagenesis + binding affinity assays
Quinone bindingR45, Q48, Y54, C147, T148 (in PcQOR)Substrate redistribution in active siteMutagenesis + activity assays with various quinones
Catalytic siteResidues near nicotinamide binding siteElectron transfer facilitationMutagenesis + kinetic parameter determination
Substrate access channelA57, A56, Q292 (in PcQOR)Control of substrate size selectivityMutagenesis + activity assays with different-sized substrates

Experimental verification should include:

  • Site-directed mutagenesis of conserved residues

  • Expression and purification of mutant proteins

  • Enzymatic assays comparing wild-type and mutant activities

  • Structural analysis of mutants (where possible)

  • Substrate specificity profiling

Studies with other QORs have shown that mutations in the substrate-binding pocket can significantly alter substrate specificity and catalytic efficiency . For example, enzymatic assays with PcQOR demonstrated high activity toward large substrates like 9,10-phenanthrenequinone, correlating with the more open substrate-binding pocket structure .

How does this protein integrate into the broader context of chloroplast electron transport?

The NAD(P)H-quinone oxidoreductase complex plays several critical roles in chloroplast electron transport:

  • Cyclic Electron Transport: The NDH complex participates in cyclic electron flow around Photosystem I, helping balance the ATP/NADPH ratio needed for carbon fixation .

  • Chlororespiration: The complex may function in chlororespiration, a respiratory electron transport chain in chloroplasts that operates in the dark or under stress conditions.

  • Photoprotection: By providing an alternative electron sink, the NDH complex helps prevent over-reduction of the photosynthetic electron transport chain, reducing oxidative damage.

  • Stress Response: NDH activity increases under various stress conditions, suggesting a role in stress adaptation.

What are the optimal approaches for measuring enzymatic activity of recombinant NAD(P)H-quinone oxidoreductase?

Enzymatic activity of NAD(P)H-quinone oxidoreductase can be measured using several complementary approaches:

  • Spectrophotometric Assays:

    • Monitoring NAD(P)H oxidation by following absorbance decrease at 340 nm

    • Measuring quinone reduction using substrate-specific wavelengths

    • Standard reaction conditions typically include:

      • Buffer: 50-100 mM phosphate or Tris buffer (pH 7.0-7.5)

      • NAD(P)H: 100-200 μM

      • Quinone substrate: 50-100 μM (various quinones like plastoquinone, benzoquinone, or 9,10-phenanthrenequinone)

      • Temperature: 25-30°C

      • Controls: Reactions with enzyme inhibitors (like dicoumarol) to verify specificity

  • Oxygen Consumption Assays:

    • Using oxygen electrodes to monitor potential redox cycling activity

    • Important for distinguishing two-electron versus one-electron reduction mechanisms

  • High-Performance Liquid Chromatography (HPLC):

    • Separation and quantification of substrates and products

    • Allows direct measurement of quinone reduction to hydroquinone

  • Substrate Specificity Profiling:

    • Testing activity with various quinones of different structures and sizes

    • Previous studies with similar enzymes showed that PcQOR readily catalyzes large substrates like 9,10-phenanthrenequinone, while having little effect on sugar compounds

When conducting kinetic analyses, it's important to determine key parameters (Km, Vmax, kcat) for both NAD(P)H and quinone substrates to fully characterize the enzyme's catalytic efficiency.

What crystallization techniques are most promising for structural studies of this protein?

Based on successful approaches with similar proteins, the following crystallization strategies may be effective:

  • Initial Screening:

    • Commercial sparse matrix screens specifically designed for membrane-associated proteins

    • Typical protein concentrations: 5-15 mg/mL

    • Temperature: Both 4°C and 20°C should be tested

    • Method: Sitting drop vapor diffusion is commonly successful for similar proteins

  • Optimization Parameters:

    • Protein-to-reservoir ratio variations (1:1, 1:2, 2:1)

    • Addition of NAD(P)H (1-5 mM) to stabilize protein conformation

    • Inclusion of mild detergents to maintain solubility

    • Testing additives that promote crystal contacts

  • Co-crystallization Strategies:

    • With bound NADPH to stabilize conformation (as achieved with PcQOR at 2.4 Å resolution)

    • With quinone substrates or substrate analogs

    • With inhibitor compounds to probe binding site

  • Cryoprotection:

    • Careful optimization of cryoprotectants to prevent ice formation

    • Commonly used agents include glycerol, ethylene glycol, or low molecular weight PEGs

For diffraction data collection, synchrotron radiation sources are recommended due to the typically small crystal size and moderate diffraction quality of these proteins. Processing of diffraction data should follow standard protocols, with particular attention to space group determination and potential twinning issues that have been observed in some quinone oxidoreductase crystals.

How can site-directed mutagenesis best inform understanding of substrate specificity determinants?

A systematic approach to site-directed mutagenesis can reveal key determinants of substrate specificity:

  • Target Identification Strategy:

    • Sequence alignment of Buxus microphylla NAD(P)H-quinone oxidoreductase with homologs from diverse species

    • Structural analysis of related enzymes with known substrate preferences

    • Focus on three key regions:

      • NAD(P)H binding pocket (conserved but with some species variations)

      • Substrate access channel (determining size selectivity)

      • Quinone binding site (determining specificity)

  • Mutation Design Principles:

    • Conservative substitutions to probe specific interactions

    • Charge reversals to test electrostatic contributions

    • Size alterations to examine steric constraints

    • Multiple mutations to test cooperative effects

  • Experimental Workflow:

    • Design mutagenesis primers carefully to ensure specificity

    • Confirm mutations by DNA sequencing

    • Express and purify mutant proteins using identical protocols to wild-type

    • Characterize kinetic parameters with multiple substrates

    • Compare substrate specificity profiles across mutants

  • Analysis Framework:

    • Determine kinetic parameters (Km, kcat, kcat/Km) for each substrate

    • Create specificity profiles across different quinone substrates

    • Correlate changes in specificity with structural features

Previous studies with PcQOR identified residues like R45, Q48, Y54, C147, and T148 as important for substrate binding and catalysis . Similar approaches can identify the corresponding residues in Buxus microphylla NAD(P)H-quinone oxidoreductase and determine their roles in substrate specificity.

What approaches are most effective for studying protein-protein interactions within the NDH complex?

Understanding how NAD(P)H-quinone oxidoreductase subunit 4L interacts with other components of the NDH complex requires specialized techniques:

  • Co-immunoprecipitation (Co-IP):

    • Using antibodies against subunit 4L to pull down interacting partners

    • Western blotting to identify co-precipitated proteins

    • Mass spectrometry for unbiased identification of interacting proteins

  • Blue Native PAGE:

    • Preserves native protein complexes during electrophoresis

    • Can resolve different subcomplexes containing the protein of interest

    • Second-dimension SDS-PAGE separates individual subunits

  • Chemical Cross-linking coupled with Mass Spectrometry (XL-MS):

    • Uses bifunctional cross-linkers to capture protein-protein interactions

    • Mass spectrometry identifies cross-linked peptides

    • Provides spatial constraints for modeling interactions

  • Cryo-Electron Microscopy:

    • Single-particle analysis to determine structure of entire NDH complex

    • Subunit localization within the complex

    • Conformational changes upon substrate binding

  • Förster Resonance Energy Transfer (FRET):

    • Fluorescently labeled proteins to detect proximity in vivo

    • Can provide dynamic information about complex assembly

For the chloroplast NDH complex specifically, approaches that maintain the native membrane environment are particularly valuable, as the complex structure depends on lipid interactions. Techniques like native mass spectrometry of membrane complexes or lipid nanodiscs can preserve these interactions during analysis.

How might environmental stresses affect expression and function of Buxus microphylla NAD(P)H-quinone oxidoreductase?

Understanding stress responses is critical for plant biochemistry and physiology research:

  • Stress Condition Analysis:

    • Examine transcriptomic data to assess ndhE expression under various stresses (drought, temperature, salinity)

    • Compare protein abundance using targeted proteomics

    • Measure NAD(P)H-quinone oxidoreductase activity in plants exposed to different stresses

  • Methodological Approaches:

    • qRT-PCR for gene expression analysis

    • Western blotting with anti-NdhE antibodies for protein quantification

    • Activity assays from isolated thylakoid membranes

    • Chlorophyll fluorescence measurements to assess electron transport capacity

Previous research with other plants suggests that NDH complex activity increases under various stress conditions, particularly during drought and high light stress. These changes may reflect the complex's role in cyclic electron flow, which helps balance ATP/NADPH ratios under stress conditions. The particular adaptations of Buxus microphylla, an evergreen shrub that tolerates various environmental conditions, may provide insights into stress-adaptive mechanisms of the photosynthetic apparatus.

What are the best approaches for in vivo studies of this protein's function in chloroplasts?

In vivo functional studies require specialized approaches for chloroplast proteins:

  • Genetic Manipulation Strategies:

    • Chloroplast transformation to introduce tagged versions of the protein

    • CRISPR-based approaches targeting nuclear-encoded assembly factors

    • RNAi or antisense strategies to reduce expression

  • Functional Phenotyping Methods:

    • Chlorophyll fluorescence analysis:

      • Pulse-amplitude modulation (PAM) fluorometry

      • Fast chlorophyll fluorescence transients (OJIP test)

      • P700 redox kinetics to assess cyclic electron flow

    • Gas exchange measurements

    • Growth analysis under different light regimes

  • Subcellular Localization Techniques:

    • Fluorescent protein fusions (with careful design to maintain function)

    • Immunogold electron microscopy using specific antibodies

    • Subfractionation of chloroplast membranes followed by Western blotting

  • Dynamic Studies:

    • Time-resolved spectroscopy to monitor electron transfer events

    • Inducible expression systems to study assembly processes

Such approaches can reveal how the protein contributes to photosynthetic efficiency under different environmental conditions and developmental stages.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.