Recombinant Buxus microphylla Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Production and Biochemical Properties

ParameterValue/DescriptionSource
Expression SystemE. coli
Purification TagN-terminal His-tag
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based, 6% trehalose (pH 8.0) or glycerol (50%)
Molecular Weight~56 kDa (predicted from AA sequence)

Reconstitution: Lyophilized powder is dissolved in sterile water (0.1–1.0 mg/mL) . Long-term storage requires aliquoting at -20°C/-80°C .

Functional Role in PSII

CP47 (psbB) is a core antenna protein that:

  1. Binds chlorophyll: Facilitates light energy absorption and transfer to the PSII reaction center .

  2. Stabilizes PSII supercomplexes: Interacts with CP43 and the oxygen-evolving complex (OEC) .

  3. Regulates translation: Polysome association of psbB transcripts is modulated by assembly factors like FPB1 .

Research findings:

  • In fpb1 mutants, psbB transcripts shift to higher polysome fractions, indicating enhanced translation efficiency .

  • CP47’s structural homology to PsaA/PsaB in PSI suggests conserved light-harvesting mechanisms .

Comparative Analysis with Other Species

SpeciesUniProt IDAA Sequence IdentityTagSource
Buxus microphyllaA6MM62Full-length (1–508 aa)His
Anthoceros formosaeQ85AI7508 aa (hornwort)His
Spinacia oleraceaP04160508 aa (spinach)His

Key differences:

  • Buxus microphylla psbB shares conserved chlorophyll-binding domains with higher plants and hornworts .

  • Cyanobacterial CP47 lacks extrinsic OEC proteins but retains core structural features .

Applications in Research

  1. PSII assembly studies: Investigates interactions with CP43, PsbH, and PsbK .

  2. Chlorophyll-binding assays: Evaluates ligand interactions using His-tagged recombinants .

  3. Plant stress responses: Models light-induced damage in non-photosynthetic hosts (e.g., E. coli) .

Experimental tools:

  • Antibodies (e.g., AS04 038) for Western blotting and CN-PAGE .

  • Co-expression with D1/D2 proteins to study reaction center assembly .

Challenges and Future Directions

  • Stability issues: Repeated freeze-thaw cycles degrade recombinant psbB .

  • Functional validation: Limited data on Buxus microphylla psbB’s role in vivo compared to model plants (e.g., Arabidopsis) .

  • Structural studies: High-resolution X-ray crystallography needed to resolve chlorophyll orientations .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Buxus microphylla (Littleleaf boxwood) (Japanese boxwood)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLAVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQS VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGVSLAENKSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTRRQVV
Uniprot No.

Target Background

Function

Recombinant Buxus microphylla Photosystem II CP47 chlorophyll apoprotein (psbB) is a core component of the Photosystem II (PSII) complex. It binds chlorophyll and participates in catalyzing the primary light-driven photochemical reactions of PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H₂O, generating O₂ and a proton gradient subsequently used for ATP synthesis.

Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the genetic structure of the psbB gene in Buxaceae species?

The psbB gene encoding CP47 chlorophyll apoprotein is located in the chloroplast genome. In Buxaceae species like Buxus megistophylla (related to B. microphylla), the chloroplast genome has a total size of approximately 157,611 bp and contains a large single-copy region (LSC) of 85,930 bp, a small single-copy region (SSC) of 18,319 bp, and two inverted repeat regions (IRs) of 26,681 bp . The psbB gene is one of the 89 protein-coding genes found in the chloroplast genome, which also includes 31 transfer RNA genes and 4 ribosomal RNA genes .

How does the amino acid sequence of CP47 chlorophyll apoprotein influence its functionality?

The amino acid sequence of CP47 determines its three-dimensional structure, which in turn dictates how the protein binds chlorophyll molecules and other cofactors. While the exact sequence for Buxus microphylla CP47 is not provided in the search results, we can reference the related Draba nemorosa CP47 sequence, which consists of 508 amino acids . The sequence contains regions responsible for membrane spanning, chlorophyll binding, and protein-protein interactions with other components of PSII. The specific arrangement of amino acids creates the protein scaffold that positions chlorophyll molecules at precise distances and orientations for optimal excitation energy transfer .

What expression systems are suitable for producing recombinant CP47 protein?

For recombinant expression of CP47, E. coli has been demonstrated as a viable system, as evidenced by the successful production of full-length Draba nemorosa CP47 with an N-terminal His-tag . Alternatively, the Chlamydomonas reinhardtii chloroplast has emerged as a promising expression platform for photosynthetic proteins, offering the advantage of a native-like environment for proper folding and assembly . The C. reinhardtii expression system is particularly valuable for membrane proteins like those in photosystems, as demonstrated by the successful expression of other integral membrane proteins in this organism .

What methodologies are effective for determining the excitation energy profile of CP47 chlorophylls?

To map excitation energies among CP47 chlorophylls, researchers employ multiscale quantum mechanics/molecular mechanics (QM/MM) approaches utilizing time-dependent density functional theory (TD-DFT) with range-separated functionals. This methodology enables accurate computation of excitation energies for all chlorophyll molecules within a complete membrane-embedded photosystem II dimer .

The protocol involves:

  • Preparation of a complete computational model of "near-native" cyanobacterial PSII

  • Application of TD-DFT calculations with appropriate functionals to individual chlorophylls

  • Quantification of the electrostatic effects of the protein environment on chlorophyll site energies

  • Determination of the ranking of site energies among the 16 chlorophyll molecules in CP47

This approach has revealed that chlorophylls B3 and B1 are the most red-shifted in CP47, differing from previous hypotheses in the literature and providing an alternative basis for evaluating past approaches .

How do structural changes in isolated CP47 compare to its native membrane-embedded form?

Molecular dynamics simulations of isolated CP47 compared to membrane-embedded CP47 reveal distinct structural differences with significant implications for experimental studies using extracted samples. When CP47 is removed from its native membrane environment, certain regions of the protein exhibit increased flexibility and potential for conformational changes .

Key findings from molecular dynamics studies include:

  • Specific regions of isolated CP47 show higher root-mean-square deviation (RMSD) values

  • Changes in the protein structure can alter the positions and orientations of bound chlorophyll molecules

  • These structural perturbations directly impact the excitation energy landscape of the complex

  • Experimental studies using isolated CP47 should account for these structural changes when interpreting spectroscopic data

These observations are critical for researchers conducting spectroscopic studies on isolated light-harvesting complexes, as the altered protein structure can significantly affect the electronic properties of the embedded chlorophylls .

What strategies can enhance recombinant expression yields of photosystem proteins in chloroplasts?

Several strategies have been explored to optimize recombinant protein expression in chloroplasts, particularly for challenging membrane proteins like those in photosystems:

  • Promoter and 5'UTR selection: Utilization of the psaA promoter/5'UTR element has demonstrated increased protein expression levels compared to other regulatory elements .

  • Co-expression of molecular chaperones: Co-expression of chaperones such as Spy has shown positive effects on recombinant protein accumulation, potentially by assisting in proper folding .

  • Optimization of cultivation conditions: Protein productivity is protein-specific, but general improvements have been observed under the following conditions:

    • Temperature: 30°C has been identified as optimal

    • Growth mode: Mixotrophic conditions (combination of photosynthesis and organic carbon source)

    • Light intensity: Optimized based on specific protein characteristics

  • Targeted gene knockouts: Strategic inactivation of specific photosystem genes (e.g., psbC, psbK) can be employed to redirect cellular resources toward recombinant protein production .

What are the phylogenetic relationships between CP47 sequences across Buxaceae and related families?

Phylogenetic analysis of chloroplast genomes, including the psbB gene encoding CP47, provides insights into evolutionary relationships within Buxaceae and related families. Using maximum-likelihood methods with 1000 bootstrap replicates, researchers have established that Buxus species form a distinct clade .

Within this family:

  • Buxus microphylla and Pachysandra terminalis cluster together under the same node

  • Buxus megistophylla appears relatively distant from these two species

  • All three Buxaceae species form a monophyletic group distinct from other families

This phylogenetic information is valuable for understanding the evolution of photosynthetic proteins across related species and may inform the selection of expression systems or the design of chimeric proteins for specific research applications.

How can site-directed mutagenesis of CP47 be used to investigate energy transfer mechanisms in Photosystem II?

Site-directed mutagenesis of the CP47 protein provides a powerful approach to investigate the relationship between specific amino acid residues and energy transfer mechanisms in Photosystem II. By systematically replacing key residues that interact with chlorophyll molecules or participate in protein-protein interactions, researchers can:

  • Identify crucial amino acids that position chlorophylls for optimal excitation energy transfer

  • Determine how changes in the protein environment affect chlorophyll site energies

  • Map energy transfer pathways from CP47 to the reaction center

  • Validate computational models of excitation energy transfer

When designing site-directed mutagenesis experiments, researchers should target:

  • Residues that provide axial ligands to chlorophyll molecules

  • Amino acids that create the hydrophobic binding pockets for chlorophylls

  • Residues involved in hydrogen bonding with chlorophyll substituents

  • Interface regions between CP47 and other PSII subunits

The effects of mutations can be assessed using a combination of spectroscopic methods, including absorption, fluorescence, and circular dichroism spectroscopy, as well as time-resolved measurements to track energy transfer kinetics .

What is the recommended protocol for purification of recombinant His-tagged CP47 protein?

For efficient purification of recombinant His-tagged CP47 protein expressed in E. coli or other systems, the following protocol is recommended:

  • Cell lysis and membrane solubilization:

    • Harvest cells by centrifugation at 5,000 × g for 15 minutes at 4°C

    • Resuspend cell pellet in lysis buffer containing 50 mM Tris-HCl (pH 8.0), 200 mM NaCl, and protease inhibitors

    • Disrupt cells using sonication or pressure homogenization

    • Solubilize membrane fraction with 1% n-dodecyl-β-D-maltoside (DDM) or similar detergent

  • Immobilized metal affinity chromatography (IMAC):

    • Load solubilized protein onto Ni-NTA or similar IMAC resin

    • Wash with buffer containing 20-40 mM imidazole to remove non-specifically bound proteins

    • Elute His-tagged CP47 with buffer containing 250-300 mM imidazole

  • Buffer exchange and concentration:

    • Dialyze against storage buffer (Tris/PBS-based buffer, pH 8.0 with 6% trehalose)

    • Concentrate using centrifugal filter devices with appropriate molecular weight cut-off

  • Storage considerations:

    • Store at -20°C/-80°C upon receipt

    • Aliquot to avoid repeated freeze-thaw cycles

    • For long-term storage, add glycerol to 50% final concentration

Protein purity should be assessed using SDS-PAGE, with expected purity greater than 90% . For reconstitution, the lyophilized protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

What analytical methods are essential for characterizing recombinant CP47 protein quality and functionality?

A comprehensive characterization of recombinant CP47 protein requires multiple analytical methods to assess its structural integrity, pigment binding, and functional properties:

For research applications requiring intact CP47-PSII complexes, additional oxygen evolution measurements can be performed to assess if the recombinant protein maintains its ability to support photosynthetic electron transport when incorporated into PSII.

How can recombinant CP47 be utilized in synthetic biology approaches to enhance photosynthetic efficiency?

Recombinant CP47 can be leveraged in synthetic biology strategies aimed at engineering enhanced photosynthetic systems with the following approaches:

  • Antenna size optimization:

    • Modified CP47 variants with altered chlorophyll binding properties can be designed to optimize light-harvesting efficiency

    • Engineering smaller antenna sizes to reduce over-absorption and subsequent energy dissipation in high light conditions

    • Creating variants with expanded spectral absorption ranges to utilize more of the available light spectrum

  • Energy transfer pathway engineering:

    • Introduction of strategic mutations to enhance the rate and efficiency of excitation energy transfer to the reaction center

    • Creation of chimeric antenna proteins combining beneficial properties from different species

    • Incorporation of non-native chromophores to expand the absorption spectrum

  • Stress tolerance improvement:

    • Engineering CP47 variants with enhanced stability under temperature, light, and oxidative stress conditions

    • Modification of vulnerable amino acid residues to improve resistance to photodamage

  • Directed evolution approaches:

    • Development of high-throughput screening systems to identify CP47 variants with improved properties

    • Iterative rounds of mutagenesis and selection to evolve enhanced photosynthetic performance

These synthetic biology approaches could potentially contribute to improved crop photosynthetic efficiency or the development of bio-inspired artificial photosynthetic systems for sustainable energy production.

What are the common challenges and solutions in expressing full-length recombinant photosystem proteins?

Expression of full-length recombinant photosystem proteins like CP47 presents several challenges due to their complex membrane-integrated nature and requirements for cofactor binding. Common challenges and their solutions include:

ChallengeDescriptionSolutions
Membrane protein insolubilityHydrophobic transmembrane domains tend to aggregate during expression- Use specialized E. coli strains (C41, C43) designed for membrane protein expression
- Express in chloroplast systems like C. reinhardtii
- Optimize detergent selection for solubilization
Protein misfoldingComplex topology of photosystem proteins leads to misfolding- Co-express molecular chaperones like Spy
- Optimize growth temperature (30°C identified as optimal)
- Include appropriate cofactors during expression
Chlorophyll incorporationProper binding of chlorophyll molecules is essential for function- Express in photosynthetic organisms capable of synthesizing chlorophyll
- Develop reconstitution methods with purified chlorophyll
- Engineer synthetic chlorophyll analogs with improved properties
Oxidative damagePhotosystem proteins are sensitive to oxidative damage- Include antioxidants in growth media
- Express under low light conditions
- Incorporate protective mutations at vulnerable sites
Low expression yieldsComplex proteins often express at low levels- Optimize regulatory elements (psaA promoter/5'UTR)
- Use mixotrophic growth conditions
- Strategic gene knockouts (psbC, psbK) to redirect resources

By addressing these challenges with the approaches outlined, researchers can improve the yield and quality of recombinant photosystem proteins for structural and functional studies.

What emerging technologies could revolutionize our understanding of CP47 structure-function relationships?

Several cutting-edge technologies are poised to transform our understanding of CP47 structure-function relationships:

  • Cryo-electron microscopy advancements:

    • Improved resolution capabilities allowing visualization of individual chlorophyll molecules and their interactions with protein residues

    • Time-resolved cryo-EM to capture different conformational states during energy transfer

  • Integrative structural biology approaches:

    • Combining X-ray crystallography, cryo-EM, NMR, and computational modeling for complete structural characterization

    • Hydrogen-deuterium exchange mass spectrometry to map dynamic regions and protein-protein interactions

  • Advanced spectroscopic methods:

    • Two-dimensional electronic spectroscopy to directly observe energy transfer pathways

    • Single-molecule spectroscopy to eliminate ensemble averaging and reveal heterogeneity

    • Ultrafast spectroscopy with improved temporal resolution to track energy transfer events

  • Computational advances:

    • Enhanced quantum mechanics/molecular mechanics (QM/MM) approaches with improved accuracy

    • Machine learning algorithms to predict effects of mutations on energy transfer efficiency

    • Molecular dynamics simulations with longer timescales to capture slower conformational changes

  • Genome editing in model organisms:

    • CRISPR-Cas9 based approaches for precise editing of psbB and related genes in chloroplast genomes

    • Creation of minimal photosynthetic systems to identify essential components

These emerging technologies, especially when used in combination, will provide unprecedented insights into how CP47 structure determines its function in photosynthetic energy transfer.

How might climate change factors affect CP47 function and what research strategies could address these impacts?

Climate change introduces multiple stressors that may affect CP47 function in natural and agricultural systems, requiring specific research strategies:

  • Temperature stress effects:

    • Research question: How do elevated temperatures alter CP47 structure and energy transfer efficiency?

    • Methodology: Combine temperature-controlled spectroscopic studies with molecular dynamics simulations to identify vulnerable regions

    • Application: Engineer temperature-resilient CP47 variants based on thermophilic organisms

  • Drought and salinity impacts:

    • Research question: How do osmotic stresses affect the stability of PSII-CP47 complexes?

    • Methodology: Compare CP47 from drought-tolerant species to identify adaptive features

    • Application: Transfer protective mechanisms to sensitive species via precision breeding

  • Elevated CO2 interactions:

    • Research question: Does altered carbon fixation under elevated CO2 affect CP47 turnover or repair?

    • Methodology: Long-term growth studies under elevated CO2 with proteomics analysis of photosystem composition

    • Application: Optimize photosystem protein expression to match enhanced carbon fixation rates

  • UV radiation damage:

    • Research question: Which regions of CP47 are most susceptible to UV-induced damage?

    • Methodology: Site-specific incorporation of UV-sensitive probes combined with mass spectrometry to map damage sites

    • Application: Introduce targeted mutations to enhance UV resistance

  • Combined stress responses:

    • Research question: How do multiple climate stressors synergistically affect CP47 function?

    • Methodology: Factorial experimental designs examining interactions between temperature, light intensity, and water availability

    • Application: Develop screening platforms to identify climate-resilient variants across multiple stress dimensions

These research directions will be essential for understanding and mitigating the impacts of climate change on photosynthetic efficiency in both natural ecosystems and agricultural systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.