Recombinant Buxus microphylla Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request if possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please communicate them to us, and we will prioritize developing the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Buxus microphylla (Littleleaf boxwood) (Japanese boxwood)
Target Names
psbA
Target Protein Sequence
MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVIGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It harnesses light energy to extract electrons from H₂O, producing O₂ and a proton gradient used for ATP formation. PSII consists of a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Recombinant Buxus microphylla Photosystem Q (B) protein and what is its significance in plant biochemistry?

    Recombinant Buxus microphylla Photosystem Q (B) protein, also known as Photosystem II protein D1 or 32 kDa thylakoid membrane protein, is a critical component of the photosynthetic machinery with an EC classification of 1.10.3.9. This protein serves as a model for studying PSII-inhibiting herbicides like terbutryn, which compete with plastoquinone at the QB binding site. The protein is encoded by the psbA gene and plays a fundamental role in electron transfer during photosynthesis. Its significance extends beyond basic photosynthesis research to applications in herbicide development and understanding mechanisms of herbicide resistance in agricultural settings. The recombinant form allows researchers to study the protein's structure-function relationships without the complexities of whole plant systems .

  • What are the key structural features of Photosystem Q (B) protein that facilitate its function?

    The Photosystem Q (B) protein contains several critical structural features that enable its role in photosynthetic electron transport. Most notably, it possesses a conserved interaction network where His215 and Ser264 form hydrogen bonds with herbicide head groups, mimicking native plastoquinone interactions. The protein also contains a hydrophobic pocket formed by Phe255 and Leu271 that stabilizes the apolar tail of inhibitors, explaining resistance mutations frequently observed in weeds. The DE loop (residues 211–275) serves as a crucial structural element that facilitates electron transfer between QA and QB. These structural elements work in concert to position plastoquinone optimally for electron acceptance and subsequent reduction during photosynthesis.

  • How does the Photosystem Q (B) protein interact with herbicides at the molecular level?

    The interaction between Photosystem Q (B) protein and herbicides occurs through specific molecular mechanisms that compete with the natural binding of plastoquinone. Structural analyses reveal that herbicides like terbutryn bind at the QB site through a conserved interaction network. His215 and Ser264 form critical hydrogen bonds with herbicide head groups, essentially mimicking the interactions that would normally occur with native plastoquinone. Additionally, the hydrophobic pocket formed by Phe255 and Leu271 stabilizes the apolar tail of inhibitors. This detailed understanding of binding interactions explains why mutations at these sites frequently confer herbicide resistance in weeds. The competition between herbicides and plastoquinone at the QB site disrupts electron flow, ultimately inhibiting photosynthesis and causing plant death.

  • What expression systems are commonly used for producing recombinant Photosystem Q (B) protein?

    Producing functional recombinant Photosystem Q (B) protein requires careful consideration of expression systems due to its membrane-associated nature. Common expression systems include specialized Escherichia coli strains designed for membrane protein expression (such as C41/C43 derivatives), insect cell systems (Sf9, High Five), and cell-free expression systems supplemented with lipids or detergents. Expression typically employs a tag system (often His-tag) to facilitate purification, with the tag placed at the N-terminus to minimize interference with function. Expression conditions generally include lower temperatures (16-20°C) and careful induction parameters to balance protein yield with proper folding and membrane insertion. The recombinant protein is typically stored in a Tris-based buffer with 50% glycerol, with storage at -20°C for short-term use or -20°C to -80°C for extended storage .

Advanced Research Questions

  • What mutagenesis approaches reveal the most about Photosystem Q (B) protein function?

    Systematic mutagenesis approaches provide critical insights into Photosystem Q (B) protein function and herbicide interactions. Site-directed mutagenesis of key residues like Ser264 has demonstrated its crucial role in modulating herbicide affinity through hydrogen bonding interactions. Alanine-scanning mutagenesis across the DE loop (residues 211-275) has identified residues essential for electron transfer. Cysteine-pair engineering enables the creation of disulfide bridges to test hypotheses about dynamic conformational changes during electron transport. Domain-swapping experiments, where regions from homologous proteins are exchanged, help delineate species-specific adaptations. Each mutation must be evaluated through multiple functional assays, including electron transport measurements, herbicide binding kinetics, and structural analyses. When combined with crystallography or cryo-electron microscopy, these mutagenesis approaches establish clear structure-function relationships that explain herbicide resistance mechanisms and provide targets for rational protein engineering.

  • How do the biophysical properties of Photosystem Q (B) protein influence its purification strategy?

    The purification of functional Photosystem Q (B) protein requires strategies tailored to its biochemical properties as a membrane protein. Initial extraction typically employs mild detergents like n-dodecyl-β-D-maltoside (DDM) that maintain protein structure while solubilizing membrane components. Affinity chromatography using the protein's His-tag provides initial purification, followed by size exclusion chromatography to ensure homogeneity. Buffer composition is critical, with optimal conditions including 50% glycerol for stability, physiological pH (7.0-7.5), and reducing agents to prevent oxidation of sensitive residues. The purified protein exhibits highest stability when stored at -20°C for short-term use or -80°C for extended storage, with repeated freeze-thaw cycles causing denaturation. Quality assessment at each purification step through activity assays ensures the final preparation retains both structural integrity and functional activity .

  • What spectroscopic techniques provide the most valuable information about electron transfer in Photosystem Q (B) protein?

    Multiple complementary spectroscopic techniques are essential for fully characterizing electron transfer in Photosystem Q (B) protein. Time-resolved fluorescence spectroscopy monitors chlorophyll fluorescence changes that reflect the redox state of QA and the efficiency of electron transfer to QB. Electron paramagnetic resonance (EPR) detects and characterizes radical species formed during the electron transfer process, providing information about their chemical environment. Fourier-transform infrared difference spectroscopy (FTIR) identifies specific molecular vibrations associated with electron transfer events and detects subtle protein conformational changes. Circular dichroism assesses secondary structure content and monitors structural changes upon binding of plastoquinone or herbicides. Resonance Raman spectroscopy provides detailed information about chromophore interactions in the binding pocket. Combined application of these techniques under varying conditions (pH, temperature, light intensity) enables comprehensive characterization of electron transfer kinetics and the factors that regulate them .

  • How can comparative genomics inform our understanding of Photosystem Q (B) protein evolution and function?

    Comparative genomics approaches reveal crucial insights into Photosystem Q (B) protein evolution and specialization across species. Analysis of psbA gene sequences from diverse photosynthetic organisms demonstrates remarkable conservation of key functional regions while highlighting species-specific adaptations. The QB binding pocket residues (His215, Ser264) show greater conservation than peripheral regions, reflecting their essential role in electron transport. Variations in the hydrophobic pocket composition (Phe255, Leu271 region) correlate with species-specific herbicide sensitivity profiles. The DE loop (residues 211-275) shows intermediate conservation, with core functional elements maintained while allowing species-specific adaptations. Phylogenetic analysis indicates that mutations in this protein tend to follow predictable patterns when herbicide selection pressure is applied, making it possible to anticipate resistance mechanisms. These comparative insights guide protein engineering efforts to enhance photosynthetic efficiency or alter herbicide resistance profiles in crops .

  • What are the methodological approaches for studying the interaction between Photosystem Q (B) protein and herbicides?

    Studying interactions between Photosystem Q (B) protein and herbicides requires multi-faceted methodological approaches. Binding assays using isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR) quantify binding affinities and thermodynamic parameters. Competition assays with radiolabeled or fluorescent herbicides measure displacement by unlabeled compounds. Co-crystallization of protein-herbicide complexes provides atomic-level details of binding geometry and key interactions. Molecular dynamics simulations predict binding modes and conformational changes induced by different herbicides. Functional impact assessment through electron transport measurements correlates binding with inhibitory potency. Site-directed mutagenesis of key residues (particularly His215, Ser264, Phe255, Leu271) followed by binding and functional studies reveals the contribution of specific amino acids to herbicide selectivity. These approaches collectively enable rational design of herbicides with improved properties or engineering of crops with altered herbicide sensitivity profiles.

  • What are the challenges and solutions in crystallizing Photosystem Q (B) protein for structural studies?

    Crystallizing Photosystem Q (B) protein presents significant challenges due to its membrane-associated nature. The hydrophobic transmembrane regions tend to form aggregates rather than ordered crystals in traditional vapor diffusion setups. Several methodological approaches address these challenges: lipidic cubic phase (LCP) crystallization provides a membrane-like environment that stabilizes the protein in its native conformation; adding antibody fragments (Fab or nanobody) increases the hydrophilic surface area available for crystal contacts; systematically screening detergents identifies conditions that maintain protein stability while promoting crystal formation; co-crystallization with bound herbicides or plastoquinone analogs stabilizes specific conformations. Microcrystallography at synchrotron sources enables data collection from smaller crystals, while serial crystallography using X-ray free-electron lasers allows room-temperature data collection without radiation damage. These advanced approaches have revolutionized membrane protein crystallography, making previously intractable targets accessible to structural analysis.

  • How do the electron transfer kinetics between QA and QB compare between wild-type and mutant Photosystem Q (B) proteins?

    Electron transfer kinetics between QA and QB show distinctive differences between wild-type and mutant Photosystem Q (B) proteins, providing insights into structure-function relationships. In wild-type protein, the first electron transfer from QA to QB occurs with a time constant of approximately 100-200 μs under optimal conditions, while the second electron transfer proceeds with a time constant of 300-600 μs. Mutations in the DE loop (residues 211-275) can dramatically alter these kinetics. For example, mutations at Ser264 typically slow electron transfer by 2-10 fold, depending on the specific substitution. Mutations affecting the hydrophobic pocket (Phe255, Leu271) can reduce electron transfer rates by altering QB binding geometry. Interestingly, some mutations that confer herbicide resistance maintain near-wild-type electron transfer kinetics while specifically disrupting herbicide binding, explaining their selective advantage in the field. Time-resolved spectroscopic techniques including fluorescence decay measurements and EPR spectroscopy are essential for quantifying these kinetic differences .

  • What experimental approaches can differentiate between herbicide resistance mechanisms in Photosystem Q (B) protein?

    Differentiating between herbicide resistance mechanisms in Photosystem Q (B) protein requires systematic experimental approaches. Site-directed mutagenesis introducing known resistance mutations (e.g., Ser264Gly, Phe255Ile) into recombinant protein allows detailed characterization of their effects. Herbicide binding assays using isothermal titration calorimetry or surface plasmon resonance quantify changes in binding affinity (Kd) for different herbicide classes. Electron transport measurements assess the functional impact of mutations on photosynthetic efficiency. Structural studies through crystallography or cryo-electron microscopy visualize altered binding interactions. Competition assays between different herbicide classes on wild-type and mutant proteins reveal cross-resistance patterns. These approaches collectively distinguish between resistance mechanisms involving altered binding site geometry, modified hydrogen bonding patterns, steric hindrance, or changes in protein dynamics. The resulting data enable prediction of cross-resistance patterns and guide the development of herbicides that remain effective against resistant biotypes.

  • How can recombinant Photosystem Q (B) protein be utilized in drug discovery and herbicide development?

    Recombinant Photosystem Q (B) protein serves as a powerful platform for rational herbicide design and development. High-throughput screening assays using purified protein identify compounds that bind the QB site with high affinity. Structure-based design approaches leverage crystallographic data of protein-herbicide complexes to optimize binding interactions with key residues like His215 and Ser264. Fragment-based screening identifies chemical scaffolds with novel binding modes that may overcome resistance. Competition assays with natural plastoquinone measure the ability of compounds to displace the native substrate. Comparative studies using Photosystem Q (B) proteins from different species (crops versus weeds) enable development of selective herbicides. Mutagenesis coupled with binding studies identifies compounds that maintain effectiveness against known resistance mutations. These approaches accelerate herbicide discovery while reducing reliance on whole-plant testing, resulting in more effective and environmentally friendly herbicides with novel modes of action to overcome resistance.

  • What methodological approaches enable the study of protein-protein interactions involving Photosystem Q (B) protein in the photosynthetic apparatus?

    Studying protein-protein interactions involving Photosystem Q (B) protein requires specialized approaches to maintain the native membrane environment. Blue native polyacrylamide gel electrophoresis (BN-PAGE) separates intact protein complexes from solubilized thylakoid membranes, revealing Photosystem Q (B) protein associations with other photosystem II components. Crosslinking mass spectrometry identifies specific residues involved in protein-protein contacts by creating covalent bonds between interacting proteins followed by mass spectrometric analysis. Co-immunoprecipitation using antibodies against Photosystem Q (B) protein pulls down interaction partners for identification. Fluorescence resonance energy transfer (FRET) measures proximity between fluorescently labeled proteins in reconstituted systems. Cryo-electron tomography visualizes the protein in its native membrane context, revealing spatial relationships with neighboring proteins. These complementary techniques collectively map the protein interaction network surrounding Photosystem Q (B) protein, providing insight into how it is incorporated into the larger photosynthetic apparatus and how these interactions influence its function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.