Recombinant C-5 sterol desaturase (erg3)

Shipped with Ice Packs
In Stock

Description

Molecular Definition and Production

Recombinant C-5 sterol desaturase (Erg3) refers to the ERG3-encoded enzyme produced via heterologous expression systems. For example, Chlamydomonas reinhardtii ERG3 cDNA has been expressed in Saccharomyces cerevisiae to restore ergosterol biosynthesis in erg3 knockout strains . Commercial versions, such as the His-tagged full-length protein (1–300 amino acids) expressed in E. coli, are available for research use .

Key Specifications of a Recombinant Erg3 Protein :

PropertyDetail
SourceE. coli expression system
TagN-terminal His tag
Protein LengthFull-length (1–300 amino acids)
FormLyophilized
FunctionCatalyzes C-5(6) sterol desaturation

Functional Role in Sterol Biosynthesis

Erg3 is a member of the fatty acid hydroxylase superfamily, characterized by four iron-binding domains critical for catalysis . It converts substrates like episterol to ergosta-5,7-dienol in yeast or lathosterol to 7-dehydrocholesterol in humans . In Candida albicans, ERG3 inactivation disrupts ergosterol synthesis, leading to azole resistance . Recombinant Erg3 expression reverses these phenotypes, confirming its enzymatic necessity .

Mechanistic Insights :

  • Requires NAD(P)H and molecular oxygen.

  • Utilizes a histidine-rich iron-coordination site for hydrogen abstraction.

  • Mutations in conserved residues (e.g., Thr114 in Arabidopsis) impair activity.

Applications in Antifungal Resistance Research

Recombinant Erg3 is pivotal for studying resistance mechanisms. For instance:

  • Azole Resistance: C. albicans clinical isolates with ERG3 mutations (e.g., double base deletions or G111R substitutions) exhibit high-level azole resistance due to ergosterol depletion . Complementation with wild-type ERG3 restores susceptibility .

  • Echinocandin Interactions: ERG3 disruption in Candida parapsilosis elevates echinocandin MICs, linking sterol profiles to drug efficacy .

Table 1: Impact of ERG3 Mutations on Antifungal Susceptibility

OrganismMutationSterol Profile AlterationAzole MIC ChangeEchinocandin MIC Change
C. albicanserg3-1Ergosterol loss, episterol accumulationIncreasedN/A
C. parapsilosisG111RReduced C-5 desaturase activityIncreasedIntermediate/Resistant
A. fumigatuserg3B knockoutAccumulation of non-C-5 sterolsUnchangedUnchanged

Species-Specific Functional Variation

Erg3 orthologs show functional divergence across species:

  • Aspergillus fumigatus: Three paralogs (Erg3A, Erg3B, Erg3C) exist. Erg3B is the primary C-5 desaturase, while Erg3A has no detectable role in sterol biosynthesis .

  • Chlamydomonas reinhardtii: Recombinant CrERG3 fully complements yeast erg3 knockouts, restoring ergosterol synthesis and acetate utilization .

  • Rhizopus delemar and Cryptococcus neoformans: Erg3 paralogs exhibit varying desaturase activities, influencing ergosterol levels and drug susceptibility .

Challenges and Future Directions

While recombinant Erg3 enables mechanistic studies, unresolved questions include:

  • Compensatory mechanisms in ERG3-null strains (e.g., A. fumigatus) .

  • Structural determinants of substrate specificity across species .

  • Engineering Erg3 variants for industrial applications (e.g., sterol production).

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag if possible.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-300
Protein Length
full length protein
Target Names
erg3
Target Protein Sequence
MRDPVLFAIPCFLLLLILEWTAARKLESIETAATGQPRPASGAYLTRDSVASISMGLVSI ATTAGWKSLALLGYAAIYAYLAPWQLSAHRWYTWVIAIVGVDLLYYSYHRIAHRVRLIWA THQAHHSSEYFNFATALRQKWNNSGEILMWVPLPLMGLPPWMVFCSWSLNLIYQFWVHTE RIDRLPRWFEFVFNTPSHHRVHHGMDPVYLDKNYGGILIIWDRLFGSFQPELFRPHYGLT KRVDTFNIWKLQTREYVAIVRDWRSATRLRDRLGYVFGPPGWEPRTIDKSNAAASLVTSR
Uniprot No.

Q&A

What is C-5 sterol desaturase (ERG3) and what role does it play in sterol biosynthesis?

C-5 sterol desaturase (ERG3) is an enzyme that catalyzes the introduction of a double bond at the C-5 position in the B-ring of sterols during the biosynthesis pathway. In fungi, it plays a crucial role in converting delta-7 sterols (such as stellasterol) into ergosterol or other downstream products . The enzyme contains histidine-rich domains that are highly conserved across species, which are essential for its catalytic activity . ERG3 represents a critical step in sterol biosynthesis, and its function impacts membrane integrity, stress responses, and antifungal susceptibility in many fungal species.

How can researchers confirm the C-5 sterol desaturase activity of an ERG3 homolog?

To confirm C-5 sterol desaturase activity, researchers should:

  • Substrate conversion assays: Treat wild-type strains and ERG3 deletion mutants with a potential substrate (e.g., stellasterol) and analyze sterol profiles using GC-MS .

  • Complementation studies: Express the candidate ERG3 gene in a yeast erg3Δ mutant and test for restoration of phenotypes such as cycloheximide resistance or growth on acetate media .

  • Sterol profile analysis: Compare sterol compositions between wild-type and mutant strains, looking specifically for the accumulation of substrate sterols (e.g., ergosta-7,22-dienol or episterol) and the absence of products requiring C-5 desaturation .

For example, in P. capsici, researchers confirmed PcErg3 activity by demonstrating that wild-type strains converted stellasterol into downstream products, while PcERG3Δ transformants could not perform this conversion, as shown in sterol detection chromatograms .

What methods are most effective for generating ERG3 deletion mutants across different fungal species?

The generation of ERG3 deletion mutants varies by organism but generally involves:

  • Homologous recombination: Design constructs with selection markers (e.g., URA3, drug resistance cassettes) flanked by homologous regions of the ERG3 gene .

  • CRISPR-Cas9 system: For organisms with lower homologous recombination efficiency.

  • Verification strategies:

    • PCR analysis to confirm correct integration

    • RT-PCR to verify absence of transcript

    • Sterol profile analysis by GC-MS to confirm functional consequences

In Saccharomyces cerevisiae, researchers successfully generated erg3Δ strains by replacing the ERG3 gene with the URA3 marker in a diploid strain, followed by sporulation to obtain haploid mutants . For Candida species, expanded toolkits of drug resistance cassettes have enabled both single gene deletions and sequential or simultaneous multi-gene deletions .

How can phenotypic assays be used to characterize ERG3 mutants?

Several well-established phenotypic assays can characterize ERG3 mutants:

  • Growth in presence of cycloheximide: ERG3-deficient yeast strains exhibit hypersensitivity to low, non-lethal levels of cycloheximide .

  • Growth on acetate media: Loss of ERG3 function impairs growth on acetate as the sole carbon source .

  • Calcium tolerance: In some fungi, ERG3 deletion affects calcium tolerance; high calcium concentration growth assays can differentiate mutants from wild-type strains .

  • Detergent sensitivity: SDS sensitivity tests can reveal abnormal membrane function in ERG3 mutants .

  • Morphological changes: In dimorphic fungi like C. albicans, ERG3 mutants may show defects in hyphal formation on inducing media like M199 or serum-containing agar .

These assays provide functional evidence of ERG3 activity and can be used to assess the complementation efficiency of recombinant ERG3 genes from different species.

How do C-5 sterol desaturases from different fungal pathogens vary in function?

C-5 sterol desaturases show significant functional differences across fungal species despite sequence homology:

SpeciesERG3 VariantFunctional CharacteristicsErgosterol ContentReference
C. albicansCaERG3Full C-5 desaturase activity~88%
C. aurisCaurERG3Comparable to CaERG3Similar to CaERG3
C. glabrataCgERG3Reduced activityLower than CaERG3
R. delemarRdERG3ASignificantly reduced activitySignificantly lower
R. delemarRdERG3BComparable to CaERG3Similar to CaERG3
A. fumigatusAfERG3APartial activitySimilar to CaERG3
A. fumigatusAfERG3BComparable to CaERG3Similar to CaERG3
A. fumigatusAfERG3CNo detectable activityNone (similar to erg3Δ/Δ)

These functional differences manifest in phenotypic assays, where strains expressing variants with reduced activity show intermediate phenotypes between wild-type and complete knockout strains .

Why do some organisms maintain ERG3 despite losing the complete sterol synthesis pathway?

This evolutionary paradox is exemplified by Phytophthora species:

  • Retained enzymatic activity: Despite losing the sterol synthesis pathway, P. capsici PcErg3 retains C-5 sterol desaturase activity when provided with an appropriate substrate .

  • Functional significance: In P. capsici, ERG3 is expressed in all developmental stages, with higher expression in sporangium and mycelium stages .

  • Possible explanations:

    • ERG3 may have alternative functions beyond sterol biosynthesis

    • It might process exogenous sterols obtained from hosts or environment

    • The gene could be maintained as an evolutionary remnant with diminishing selective pressure

    • It may participate in specialized metabolic pathways unique to these organisms

Interestingly, deletion of PcERG3 in P. capsici did not significantly impair development or pathogenicity, suggesting that while the enzyme maintains its biochemical activity, its physiological role may have changed or diminished .

How does ERG3 dysfunction contribute to azole antifungal resistance?

ERG3 plays a critical role in the mechanism of azole antifungal action and resistance:

  • Toxic sterol hypothesis: Azoles inhibit sterol 14α-demethylase (S14DM), leading to the accumulation of 14α-methylated sterols that are processed by ERG3 into toxic sterol diols, disrupting membrane function .

  • Resistance mechanism: ERG3 inactivation prevents the formation of these toxic sterol diols, allowing fungi to grow despite S14DM inhibition by azoles .

  • Species conservation: This mechanism appears conserved across multiple Candida species. Deletion of ERG3 in C. glabrata, C. auris, and C. albicans prototrophic strains consistently results in azole resistance .

  • ERG5 contrast: Unlike ERG3, deletion of ERG5 (which acts later in the pathway) in C. glabrata maintains azole susceptibility at subinhibitory concentrations, supporting the specific role of ERG3 in the toxic sterol model .

This understanding has important implications for both antifungal resistance surveillance and the development of combination therapies that might target both S14DM and alternative pathways.

What methodologies are used to study ERG3's role in antifungal susceptibility?

Researchers employ several approaches to investigate ERG3's involvement in antifungal responses:

  • Gene deletion studies: Using homologous recombination or CRISPR-Cas9 to create ERG3 knockouts in various fungal species .

  • Complementation experiments: Reintroducing wild-type or mutant ERG3 genes to assess restoration of antifungal susceptibility .

  • Cross-species complementation: Expressing ERG3 from different species in a model organism to compare functional conservation .

  • Sterol profiling: Analyzing changes in sterol composition in response to azole treatment in wild-type versus ERG3 mutant strains using GC-MS .

  • Growth inhibition assays: Standardized methods like broth microdilution to determine minimum inhibitory concentrations (MICs) of antifungals.

  • Sequence analysis: Identifying naturally occurring ERG3 mutations in clinical isolates with antifungal resistance.

These methodologies can be combined to develop a comprehensive understanding of ERG3's role in antifungal susceptibility across different fungal pathogens.

What are the critical protein domains and residues required for ERG3 activity?

ERG3 contains several conserved domains crucial for its function:

  • Histidine-rich domains: Two highly conserved histidine-rich motifs corresponding to amino acids 110-132 and 191-213 in some species are essential for catalytic activity .

  • Transmembrane regions: ERG3 is typically a membrane-bound protein with multiple transmembrane domains.

  • Substrate binding sites: Specific regions involved in recognizing and positioning sterol substrates.

  • Cofactor interaction sites: Domains that interact with essential cofactors for the desaturation reaction.

Researchers can employ site-directed mutagenesis targeting these conserved residues, followed by functional complementation assays, to determine their importance for enzymatic activity. For example, introducing mutations in the histidine-rich domains would likely abolish C-5 desaturase activity even when the protein is expressed at normal levels.

How do environmental conditions affect ERG3 expression and function?

ERG3 expression and function can vary significantly based on environmental conditions:

  • Developmental regulation: In P. capsici, PcERG3 is expressed at all developmental stages but shows higher expression in sporangium and mycelium stages .

  • Stress responses: The expression may be modulated in response to various stresses, though in P. capsici, ERG3 deletion did not affect tolerance to temperature extremes, high osmotic pressure, or pH variations .

  • Nutrient availability: Changes in carbon sources or sterol availability may influence ERG3 expression.

  • Oxygen levels: As a desaturase, ERG3 function requires molecular oxygen, making its activity potentially sensitive to hypoxic conditions.

Research approaches to study these effects include:

  • RT-qPCR to measure transcript levels under different conditions

  • Reporter gene fusions to visualize expression patterns

  • Proteomic analysis to assess protein levels and post-translational modifications

  • Enzyme activity assays under varying environmental conditions

What expression systems are most effective for producing recombinant ERG3 protein?

Selecting an appropriate expression system is crucial for recombinant ERG3 studies:

  • Yeast expression systems:

    • S. cerevisiae erg3Δ strains are effective for functional complementation studies .

    • The ADH1 promoter has been successfully used to drive ERG3 expression in yeast .

    • Advantages include proper folding of membrane proteins and availability of sterol synthesis machinery.

  • Bacterial expression systems:

    • Challenging due to ERG3's membrane-associated nature.

    • May require fusion with solubility tags or expression of truncated domains.

  • Insect cell systems:

    • Baculovirus expression systems might better accommodate membrane protein expression.

    • More likely to support proper folding and post-translational modifications.

  • Mammalian cell systems:

    • Useful when studying interactions with mammalian proteins or when post-translational modifications are critical.

For functional studies, heterologous expression in erg3Δ yeast strains followed by phenotypic assays (cycloheximide sensitivity, growth on acetate) and sterol profiling provides the most direct evidence of enzymatic activity .

What are the major challenges in assaying recombinant ERG3 activity in vitro?

Researchers face several technical challenges when studying ERG3 activity:

  • Membrane association: As an integral membrane protein, ERG3 is difficult to solubilize while maintaining activity.

  • Cofactor requirements: Complete reconstitution of activity requires proper cofactors and electron transport components.

  • Substrate preparation: Sterols have poor water solubility, requiring careful formulation for in vitro assays.

  • Detection methods: Sensitive analytical techniques (GC-MS) are needed to detect sterol conversion products .

  • Standardization issues: Variations in assay conditions make cross-study comparisons difficult.

To overcome these challenges, researchers often rely on whole-cell assays rather than purified enzyme studies. For example, analyzing the sterol profiles of ERG3-expressing yeast strains after supplementation with potential substrates like stellasterol provides evidence of enzymatic activity without requiring protein purification .

How might genome editing technologies advance our understanding of ERG3 function?

Emerging genome editing technologies offer new opportunities for ERG3 research:

  • CRISPR-Cas9 applications:

    • Precise introduction of point mutations to study specific residues

    • Multiplexed editing to examine ERG3 interactions with other pathway components

    • Inducible systems to study temporal aspects of ERG3 function

    • Base editing for introducing specific amino acid changes without double-strand breaks

  • High-throughput mutagenesis:

    • Saturating mutagenesis coupled with functional selection to map all residues important for function

    • Deep mutational scanning to quantify the effect of thousands of variants simultaneously

  • In vivo tagging:

    • Endogenous tagging to study localization and dynamics without overexpression artifacts

    • Split-protein complementation to study protein-protein interactions

These approaches could help resolve questions about ERG3's unexpected retention in organisms that have lost the sterol synthesis pathway and identify new targets for antifungal development.

What are the prospects for targeting ERG3 in developing novel antifungal strategies?

ERG3 presents several opportunities for antifungal development:

  • Dual-targeting approaches: Combining ERG3 inhibitors with existing azoles might prevent the emergence of resistance through the toxic sterol bypass mechanism .

  • Species-specific targeting: The functional differences between ERG3 orthologs could be exploited to develop species-selective antifungals .

  • Resistance prediction: Genetic testing for ERG3 mutations could help predict azole resistance and guide treatment decisions.

  • Synthetic lethality: Identifying genes that become essential when ERG3 is inactivated could reveal new combination therapies.

  • ERG3 inactivation itself confers azole resistance

  • Some pathogenic fungi show minimal phenotypic consequences from ERG3 deletion

  • The complex sterol biosynthesis pathway offers multiple adaptation routes

Future research should focus on understanding the context-dependent importance of ERG3 across different fungal species and infection scenarios to develop more targeted and effective antifungal strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.