Recombinant C4-dicarboxylate transport sensor protein dctB (dctB)

Shipped with Ice Packs
In Stock

Description

Introduction to DctB Protein

DctB is an extracellular binding protein that plays a critical role in bacterial carbon metabolism, particularly in the sensing and utilization of C4-dicarboxylates such as succinate, fumarate, and malate. These organic compounds serve as important carbon and energy sources for numerous bacterial species . DctB has been identified in several bacterial species including Bacillus subtilis, Rhizobium meliloti, and Rhizobium leguminosarum, where it exhibits conserved structural and functional properties while maintaining species-specific characteristics .

Unlike traditional transport proteins that directly facilitate substrate movement across membranes, DctB functions primarily as a sensor that detects the presence of C4-dicarboxylates in the extracellular environment and triggers appropriate cellular responses. In Bacillus subtilis, genetic studies have demonstrated that DctB is required for the expression of dctA (a C4-dicarboxylate transporter) and for growth on C4-dicarboxylates, highlighting its essential role in carbon utilization pathways .

The significance of DctB lies in its unique positioning within bacterial sensing mechanisms, where it acts as a cosensor in complex with other proteins to regulate gene expression in response to environmental carbon availability. This makes DctB a fascinating subject for research in bacterial physiology, genetic regulation, and metabolic adaptation.

Protein Structure and Domains

DctB belongs to the TRAP-type (tripartite ATP-independent periplasmic) binding protein family, with homology to DctP binding proteins. In Rhizobium meliloti, the full-length DctB protein consists of 621 amino acids, while in Rhizobium leguminosarum, it contains 622 amino acids . The protein exhibits a characteristic binding protein structure that facilitates its interaction with C4-dicarboxylate substrates.

Sequence analysis has revealed that DctB from Bacillus subtilis shares significant sequence identity (approximately 37%) with the DctP binding protein from Rhodobacter capsulatus . This homology suggests a conserved structural framework across different bacterial species, although functional adaptations have evolved to suit specific metabolic requirements.

Genetic Organization

In Bacillus subtilis, the dctB gene is located upstream of the dctSR operon but in reverse orientation . This genetic arrangement is significant for understanding the coordinated regulation of C4-dicarboxylate sensing and transport systems in bacteria. The dctSR operon encodes the DctS sensor kinase and DctR response regulator, which work in concert with DctB to regulate the expression of genes involved in C4-dicarboxylate utilization.

Unlike in Rhodobacter capsulatus, where the DctP binding protein functions together with membrane components DctQ and DctM to form a complete transport system, DctB in Bacillus subtilis is considered an "orphan" binding protein, lacking the associated membrane transport components . This structural distinction underscores the specialized sensory role of DctB rather than direct involvement in substrate transport.

Expression and Purification Systems

Recombinant DctB proteins are commonly produced using prokaryotic expression systems, with E. coli being the predominant host organism for heterologous expression . The addition of histidine tags enables efficient purification using immobilized metal affinity chromatography (IMAC), yielding proteins suitable for biochemical, structural, and functional studies.

The expression of full-length DctB proteins from different bacterial species allows researchers to investigate species-specific characteristics while maintaining the core functional properties of the protein. This approach has been instrumental in elucidating the conserved sensing mechanisms across bacterial species as well as adaptations specific to particular metabolic niches.

Sensing Mechanism

DctB functions primarily as a sensor for C4-dicarboxylates in the extracellular environment. Research has demonstrated that DctB acts as a cosensor with the sensor kinase DctS, forming a critical component of the C4-dicarboxylate sensing mechanism in bacteria such as Bacillus subtilis . Through interaction experiments, including streptavidin or His protein interaction experiments (mSPINE or mHPINE) and bacterial two-hybrid systems (BACTH), researchers have confirmed direct interactions between DctB and DctS in vivo .

The sensing capability of DctB allows bacteria to detect and respond to the presence of valuable carbon sources in their environment. When C4-dicarboxylates are available, the DctB-DctS sensing system initiates a signaling cascade that ultimately leads to the expression of genes required for the uptake and metabolism of these compounds.

Regulation of Gene Expression

In Bacillus subtilis, DctB plays a crucial role in regulating the expression of dctA, which encodes a C4-dicarboxylate transporter. Genetic studies have shown that inactivation of DctB inhibits the expression of dctA, demonstrating its regulatory function . This regulation is essential for the bacterium's ability to utilize C4-dicarboxylates as carbon sources.

The regulatory mechanism involves the formation of a sensing complex that includes DctB, DctS (sensor kinase), and DctA (transporter). When C4-dicarboxylates are detected by DctB, a signal is transmitted through DctS to activate the expression of dctA, thereby enabling the uptake of these carbon compounds. This sophisticated regulatory system ensures that the metabolic machinery for C4-dicarboxylate utilization is only expressed when these substrates are available in the environment.

DctB in Bacillus subtilis

In Bacillus subtilis, DctB has been extensively studied for its role in C4-dicarboxylate sensing and regulation. Unlike in some other bacterial species, DctB in B. subtilis does not directly participate in transport but instead functions exclusively as a sensor component . Genetic deletion studies have demonstrated that DctB, along with DctS and DctR, is required for both the expression of dctA and for growth on C4-dicarboxylates .

The unique aspect of B. subtilis DctB is its participation in a tripartite sensing complex with DctS and DctA. This complex forms the functional unit for C4-dicarboxylate sensing in B. subtilis, with DctS serving as the central component that interacts with both DctB and DctA . This arrangement allows for integrated sensing and response to environmental C4-dicarboxylates.

DctB in Rhizobium Species

DctB has also been identified and characterized in Rhizobium species, including Rhizobium meliloti and Rhizobium leguminosarum . In these nitrogen-fixing bacteria, C4-dicarboxylates serve as important carbon sources during symbiotic relationships with leguminous plants. The DctB protein in Rhizobium meliloti consists of 621 amino acids, while in Rhizobium leguminosarum, it comprises 622 amino acids .

Rhizobium species represent an interesting comparative system for studying DctB function, as they inhabit different ecological niches compared to soil bacteria like B. subtilis. The conservation of DctB across these diverse bacterial species underscores its fundamental importance in bacterial carbon metabolism and environmental adaptation.

Tripartite Sensing Complex

One of the most significant research findings regarding DctB is its participation in a tripartite sensing complex in Bacillus subtilis. Experimental evidence has demonstrated that DctB interacts directly with the sensor kinase DctS, but not with the transporter DctA . Instead, DctA also interacts separately with DctS, forming a tripartite complex where DctS serves as the central component connecting DctB and DctA .

This tripartite arrangement (DctS/DctA/DctB) represents a sophisticated sensing system that integrates both extracellular substrate detection (via DctB) and transport status (via DctA) to regulate gene expression appropriately. The simultaneous presence of DctS/DctB and DctS/DctA sensor pairs, along with the lack of direct interaction between DctA and DctB, supports the model of a tripartite complex mediated by DctS .

DctB as a Cosensor

  1. Protein interaction studies using streptavidin or His protein interaction experiments (mSPINE or mHPINE) demonstrated direct interaction between DctB and DctS in vivo .

  2. Bacterial two-hybrid system (BACTH) experiments confirmed the interaction between DctS and DctB .

  3. Transport studies showed that uptake of [14C]succinate by bacteria expressing DctA from a plasmid was similar in both the absence and presence of DctB, demonstrating that DctB is not required for the transport process .

These findings highlight DctB as the first example of a TRAP-type binding protein that acts as a cosensor rather than as a transport component . This distinction is important for understanding the diverse functional adaptations of binding proteins in bacterial physiology.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but customers may adjust as needed.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
dctB; C4-dicarboxylate transport sensor protein DctB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-622
Protein Length
full length protein
Species
Rhizobium leguminosarum
Target Names
dctB
Target Protein Sequence
MHKSAMSVSQKLWPSLPLQHRIRRMWWTYAALAFLAVVASLWTSGEIGQHRAEAALEEQA RMDVTLNAALLRTVLEKYRALPFVLSQDTALAAALVGNDAGTFERLSQKLEILAAGTKAA VIYVIDKDGIAVSASNWREPTSFVGNDYRFREYFQGAVERGQAEHFALGTVSKKPGLYIS QRISGSNGLLGVVVVKVEFDDVEADWNASGTPSYVVDERGIVLITSLPSWRFMTIGRIAE DRLTAIRESLQFGAAPLQPLPLDMVRNLGEGLDVVEIVMPGDAGKTRFLDVATSVPATGW HLQHLVALGPSVDAGIREARMLALLILLPLLAGAAFLLRRRHTIALRISSEQQAREELER RVVERTLDLSQARDRLQAEIIGHKSTEQKLQAVQQDLVQANRLAILGQVAAGVAHEINQP VATIRAYADNARTFLDRGQTAPAGENLESIAALTERIGSITEELKTFARKGRGSAEPTGL KDVIEGAVMLLRSRFAGRMDTLDIDLPPDELQVMGNRIRLEQVLINLLQNALEAVAPKAG EGRVEIRTSTDAGMVTVTVADNGPGIPTEIRKGLFTPFNTSKESGLGLGLVISKDIVGDY GGRMDVASDSGGTRFIVQLRKA
Uniprot No.

Target Background

Function
Recombinant C4-dicarboxylate transport sensor protein dctB (dctB) is a member of the two-component regulatory system DctB/DctD involved in C4-dicarboxylate transport. DctB functions as a membrane-associated protein kinase, phosphorylating DctD in response to environmental cues.
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is C4-dicarboxylate transport sensor protein dctB and what role does it play in bacterial systems?

C4-dicarboxylate transport sensor protein dctB functions as a membrane-associated protein kinase that phosphorylates DctD in response to environmental signals, forming part of the two-component regulatory system DctB/DctD . This system is specifically involved in the transport of C4-dicarboxylates, which are important carbon compounds for bacterial metabolism . The dctB protein contains periplasmic domains that are presumed to be involved in C4-dicarboxylate sensing, making it critical for bacterial response to changing environmental conditions . In the context of bacterial physiology, dctB serves as a sensor that helps bacteria detect and respond to available carbon sources in their environment.

How does the two-component regulatory system DctB/DctD function in bacterial metabolism?

The DctB/DctD two-component regulatory system operates through a sophisticated signal transduction mechanism:

  • Detection: DctB functions as a sensor kinase that detects the presence of C4-dicarboxylates in the bacterial environment .

  • Signal transduction: Upon sensing C4-dicarboxylates, DctB undergoes autophosphorylation at a conserved histidine residue .

  • Phosphoryl transfer: The phosphoryl group is then transferred to DctD, the response regulator component of the system .

  • Response activation: Phosphorylated DctD activates transcription of genes involved in C4-dicarboxylate transport and metabolism .

This system allows bacteria to efficiently regulate the expression of metabolic genes in response to available carbon sources, which is essential for bacterial adaptation and survival in dynamic environments . The interaction between DctB and DctD represents a classic example of how bacteria use two-component systems to coordinate cellular responses to external stimuli.

What is known about the periplasmic domain of dctB and its role in C4-dicarboxylate sensing?

The periplasmic domain of dctB is crucial for its function as a C4-dicarboxylate sensor. Research indicates that this domain is specifically involved in direct interaction with C4-dicarboxylates . The structural arrangement of the periplasmic domain creates a binding pocket that allows for specific recognition of C4-dicarboxylate molecules such as succinate, fumarate, and malate .

In signal perception, the interaction of C4-dicarboxylates with both dctB and the DctA carrier plays an important role . This suggests a complex sensing mechanism where dctB may function in coordination with transport proteins to detect substrate availability. The conformational changes that occur in the periplasmic domain upon ligand binding are likely responsible for transmitting the signal across the membrane to the cytoplasmic kinase domain, ultimately leading to phosphorylation of DctD .

What expression systems are optimal for producing functional recombinant dctB protein?

Based on research with similar recombinant proteins, several expression systems can be utilized for dctB production, each with specific advantages:

Expression SystemAdvantagesTurnaround TimePost-translational Modifications
E. coliHigh yield, cost-effectiveShortLimited
YeastGood yield, eukaryotic processingModerateModerate
Insect cells/BaculovirusBetter folding, higher activityLongerExtensive
Mammalian cellsMost native-like processingLongestMost extensive

What purification strategies yield functional dctB protein for structural and functional studies?

Purification of membrane-associated proteins like dctB requires specialized approaches:

  • Membrane isolation: Careful isolation of membrane fractions containing the expressed dctB protein.

  • Detergent solubilization: Selection of appropriate detergents to extract dctB from membranes while preserving its native conformation.

  • Affinity chromatography: Utilizing affinity tags (His-tag, GST, etc.) for initial purification.

  • Size exclusion chromatography: Further purification to obtain homogeneous protein preparations.

  • Verification of function: Assessment of kinase activity through phosphorylation assays.

When purifying dctB, it's essential to maintain conditions that preserve its native structure and activity . This may include using stabilizing agents, working at appropriate temperatures, and minimizing exposure to conditions that could denature the protein or disrupt its interaction with lipids or other membrane components.

How should researchers design experiments to study dctB-ligand interactions and signal transduction?

When designing experiments to study dctB-ligand interactions, researchers should consider a multi-faceted approach:

  • Binding assays: Implement isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR) to quantify binding affinities between dctB and C4-dicarboxylates.

  • Structural studies: Utilize X-ray crystallography or cryo-EM to determine structural changes upon ligand binding.

  • Functional assays: Develop phosphorylation assays to measure dctB kinase activity in response to different ligands.

  • Mutagenesis studies: Create targeted mutations in potential binding residues to identify critical amino acids involved in ligand recognition.

  • In vivo reporter systems: Design bacterial reporter strains to monitor dctB/DctD pathway activation in response to different C4-dicarboxylates.

The experimental design should include appropriate controls, such as inactive variants of dctB or non-binding ligand analogs . Researchers should also consider carefully defining their variables and how they relate to each other, writing specific testable hypotheses, and planning precise measurements of dependent variables .

What controls are essential when investigating the dctB/DctD two-component system?

Robust controls are critical for research on the dctB/DctD system:

Control TypePurposeImplementation
Negative controlsEstablish baselineUse buffer without C4-dicarboxylates; dctB mutants lacking kinase activity
Positive controlsVerify system responsivenessKnown activating ligands; constitutively active dctB variants
Specificity controlsConfirm ligand specificityStructurally similar non-C4-dicarboxylate compounds
System controlsValidate downstream signalingDctD phosphorylation-deficient mutants
Environmental controlsAccount for external factorsConsistent temperature, pH, ionic conditions across experiments

How should researchers address contradictory data when studying dctB function and activity?

When confronted with contradictory data in dctB research, researchers should follow these methodological steps:

  • Thoroughly examine the data to identify specific discrepancies or patterns that contradict the initial hypothesis .

  • Compare the contradictory results with existing literature on dctB and related two-component systems .

  • Pay special attention to outliers that may have influenced the results, while maintaining an open mind to potential new discoveries .

  • Re-evaluate initial assumptions about dctB function and the experimental design used to study it .

  • Consider alternative explanations for the contradictory data, including potential interactions between dctB and other cellular components like the DctA carrier .

  • Modify the data collection process if necessary, refining variables and implementing additional controls .

Researchers should approach contradictory data as an opportunity to gain deeper insights into dctB function rather than as experimental failures . This process may lead to refined hypotheses about how dctB interacts with C4-dicarboxylates or how its signal transduction mechanism operates.

What are common challenges in recombinant dctB research and how can they be addressed?

Researchers working with recombinant dctB face several challenges:

  • Expression levels: As a membrane protein, dctB can be difficult to express at high levels in heterologous systems. Solution: Optimize codon usage, use specialized expression vectors, and test multiple host systems .

  • Protein folding: Ensuring proper folding of the periplasmic and transmembrane domains is critical for function. Solution: Consider expression in systems that provide appropriate post-translational modifications necessary for correct protein folding .

  • Maintaining activity: Preserving the kinase activity of dctB during purification can be challenging. Solution: Use stabilizing agents and conditions that mimic the native membrane environment .

  • Ligand specificity: Determining the specificity of dctB for different C4-dicarboxylates requires careful experimental design. Solution: Implement comparative binding studies with structurally related compounds.

  • Signal transduction analysis: Elucidating the mechanism of signal transduction from ligand binding to kinase activation is complex. Solution: Combine structural studies with functional assays and in vivo reporter systems.

How does the mechanism of dctB compare with other C4-dicarboxylate sensors in bacteria?

Bacteria contain several different C4-dicarboxylate sensors, each with distinct mechanisms:

  • DctB: Functions as a histidine protein kinase in the DctB/DctD two-component system, with periplasmic domains involved in C4-dicarboxylate sensing . Interaction of C4-dicarboxylates with both DctB and the DctA carrier plays an important role in signal perception .

  • DcuS: Another histidine protein kinase in the DcuS/DcuR two-component system. In DcuS, the periplasmic domain is essential for direct interaction with C4-dicarboxylates .

  • DctS: A histidine protein kinase belonging to yet another family of two-component systems involved in C4-dicarboxylate sensing .

These sensors belong to different families of two-component systems but share the common feature of containing periplasmic domains presumably involved in C4-dicarboxylate sensing . The main difference appears to be in how they interact with their specific response regulators and potentially in their affinity and specificity for different C4-dicarboxylates.

How can research on dctB contribute to our understanding of bacterial metabolism and adaptation?

Research on dctB provides valuable insights into several aspects of bacterial physiology:

  • Carbon source utilization: Understanding how bacteria detect and respond to available carbon sources through dctB helps explain their metabolic versatility .

  • Environmental adaptation: The dctB/DctD system represents a model for how bacteria sense and adapt to changes in their environment .

  • Regulatory networks: Studies of dctB contribute to our understanding of how two-component regulatory systems integrate into larger cellular networks .

  • Bacterial physiology under varying oxygen conditions: In some bacteria, C4-dicarboxylate transport is regulated in response to oxygen availability, with different transporters being utilized under aerobic versus anaerobic conditions .

  • Evolution of sensory systems: Comparative studies of dctB across bacterial species can reveal evolutionary patterns in sensory and regulatory mechanisms .

By elucidating the function and regulation of dctB, researchers gain deeper insights into bacterial metabolism, which has implications for fields ranging from environmental microbiology to pathogenesis and biotechnology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.