Recombinant Cabassous unicinctus NADH-ubiquinone oxidoreductase chain 1 (MT-ND1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-ND1; MTND1; NADH1; ND1; NADH-ubiquinone oxidoreductase chain 1; NADH dehydrogenase subunit 1; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Species
Cabassous unicinctus (Southern naked-tailed armadillo)
Target Names
Target Protein Sequence
ILLAMAFLTLVERKILGYMQLRKGPNIVGPYGLLQPIADAIKLFIKEPLRPLTSSKPMFI LAPTLAFSLALSLWIPVPMPHPLINLNLGVLFILALSSLAVYSILWSGWASNSKYALIGA LRAVAQTISYEVTLAIILLSIMMMNGSFTLSTLTTTQEHLWLVFPLWPLAMMWFISTLAE TNRAPFDLTEGESELVSGFNVEYAAGPFALFFMAEYTNIIMMNALTTTLFLGALHNPLFP ELFTVNFVTKTLLLTITFLWVRASYPRFRYDQLMHLVWKSFLPLTLALCMLHVSTPAMSA GIP
Uniprot No.

Target Background

Function

Recombinant Cabassous unicinctus NADH-ubiquinone oxidoreductase chain 1 (MT-ND1): A core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It's considered part of the minimal assembly necessary for catalytic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be its immediate electron acceptor.

Protein Families
Complex I subunit 1 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND1 and what is its primary function in cellular metabolism?

MT-ND1 (NADH-ubiquinone oxidoreductase chain 1) is a core subunit of mitochondrial respiratory chain complex I, which plays a crucial role in oxidative phosphorylation. This 36 kDa protein is encoded by the mitochondrial genome between nucleotide positions 3307 and 4262 on the heavy chain of mtDNA . Functionally, MT-ND1 contributes to the NADH dehydrogenase activity of complex I, participating in electron transport from NADH to ubiquinone and the subsequent pumping of protons across the inner mitochondrial membrane .

The electron transfer sequence in complex I follows the pathway NADH → flavin mononucleotide (FMN) → iron-sulfur clusters (FeS) → coenzyme Q (ubiquinone) . MT-ND1 specifically contributes to forming the ubiquinone binding domain and proton channel structures that are essential for energy conversion during oxidative phosphorylation, the process that generates ATP as cellular energy currency .

How is MT-ND1 positioned within the respiratory complex I structure?

MT-ND1 occupies a strategic position at the junction between the hydrophilic and hydrophobic domains of complex I . This location is functionally significant as it enables MT-ND1 to contribute to both ubiquinone binding and the proton pump structure, potentially facilitating the coupling mechanism between these two functions . The protein's transmembrane positioning allows it to form critical interactions with other subunits including nuclear-encoded proteins such as NDUFA1 . This structural arrangement is essential for maintaining the integrity of complex I and ensuring proper electron transfer and proton translocation across the mitochondrial inner membrane.

What is the evolutionary significance of studying MT-ND1 from Cabassous unicinctus compared to other species?

Studying MT-ND1 from Cabassous unicinctus (Southern naked-tailed armadillo) provides valuable evolutionary insights due to the unique ecological niche and evolutionary history of armadillos. The Cabassous genus, including related species like Cabassous centralis, has been documented to harbor specific pathogens such as Paracoccidioides brasiliensis , suggesting distinctive immunological and metabolic adaptations that may be reflected in their mitochondrial proteins.

Comparative analysis of MT-ND1 sequences across species can reveal conserved functional domains essential for complex I activity versus regions that have adapted to specific environmental or metabolic demands. For experimental approaches, researchers should consider:

  • Multiple sequence alignment of MT-ND1 from diverse mammalian species

  • Identification of conserved residues in ubiquinone binding and proton translocation regions

  • Functional characterization of species-specific amino acid variations

What are the recommended protocols for expressing and purifying recombinant MT-ND1 protein?

Expressing and purifying MT-ND1 presents significant challenges due to its hydrophobic nature and mitochondrial origin. A recommended approach involves allotopic expression, where the mitochondrial gene is recoded for cytosolic translation and targeted back to mitochondria. Based on successful methodologies reported in the literature, the following protocol can be implemented:

  • Gene optimization and construct design:

    • Recode the MT-ND1 sequence according to nuclear codon usage

    • Include a mitochondrial targeting sequence (MTS) derived from COX10 or another mitochondrial protein

    • Add 5'-UTR from a nuclear-encoded mitochondrial protein (e.g., COX10) for mRNA targeting to the mitochondrial outer membrane

    • Include 3'-UTR sequences to enhance mRNA stability

  • Expression system selection:

    • Use mammalian expression vectors such as p3XFLAG-CMV for transfection in relevant cell lines

    • Consider excluding epitope tags that might interfere with protein folding and function

  • Cell transfection and selection:

    • Transfect cells using appropriate reagents like Lipofectamine 2000

    • Select stable transfectants using antibiotics such as G418 (400 μg/mL)

    • Perform double selection by growing cells in galactose media to eliminate false positives

  • Verification of expression:

    • Use quantitative real-time PCR with primers spanning the junction between the targeting sequence and the recoded gene

    • Normalize expression using plasmid sequences that are not translated to exclude DNA contamination

    • Assess functional integration into complex I through biochemical assays

What methods are most effective for assessing MT-ND1 incorporation into functional complex I?

Evaluating successful incorporation of recombinant MT-ND1 into functional complex I requires multiple complementary approaches:

  • Biochemical assessment of complex I activity:

    • Measure NADH:ubiquinone oxidoreductase activity using spectrophotometric assays

    • Analyze oxygen consumption rates in intact cells and isolated mitochondria

    • Quantify ATP synthesis capacity through luminescence-based assays

  • Structural analysis of complex I assembly:

    • Perform blue native polyacrylamide gel electrophoresis (BN-PAGE) to visualize intact complex I and supercomplexes

    • Use western blotting with antibodies against multiple complex I subunits to confirm proper assembly

    • Implement immunoprecipitation to assess interactions between MT-ND1 and other complex I components

  • Functional complementation in MT-ND1-deficient models:

    • Assess restoration of growth in galactose media, which forces cells to rely on oxidative phosphorylation

    • Measure rescue of phenotypes associated with MT-ND1 deficiency, such as reduced complex I activity

    • Evaluate changes in reactive oxygen species (ROS) production and mitochondrial membrane potential

  • In vivo assessment:

    • Analyze mitochondrial morphology via electron microscopy or confocal imaging

    • Examine subcellular localization using immunofluorescence or fractionation techniques

    • Evaluate metabolic flux using isotope-labeled substrates

How can researchers effectively design experiments to study protein-protein interactions involving MT-ND1?

Studying protein-protein interactions of MT-ND1 requires specialized approaches due to its hydrophobic nature and mitochondrial localization:

  • Proximity-based labeling techniques:

    • APEX2 or BioID fusion proteins to identify proximal interacting partners in living cells

    • Time-resolved labeling to distinguish transient versus stable interactions during complex I assembly

  • Crosslinking mass spectrometry (XL-MS):

    • Apply chemical crosslinkers to stabilize interactions before isolation

    • Use mass spectrometry to identify crosslinked peptides and map interaction sites

    • Compare interaction landscapes in wild-type versus mutant MT-ND1 variants

  • Förster resonance energy transfer (FRET) approaches:

    • Generate fluorescent protein fusions with MT-ND1 and candidate interacting partners

    • Measure energy transfer efficiency as an indicator of protein proximity

    • Perform acceptor photobleaching or fluorescence lifetime imaging for quantitative analysis

  • Co-immunoprecipitation adaptations for membrane proteins:

    • Optimize detergent conditions to maintain native interactions while solubilizing membrane proteins

    • Use epitope-tagged versions of MT-ND1 (considering potential structural impacts)

    • Validate interactions through reciprocal pull-downs and controls for nonspecific binding

  • Molecular dynamics simulations:

    • Model interactions based on known complex I structures

    • Predict effects of mutations on protein-protein interfaces

    • Guide experimental design by identifying key residues for mutagenesis

What is the specific role of MT-ND1 in the assembly pathway of mitochondrial complex I?

MT-ND1 plays a crucial role in the early assembly stages of mitochondrial complex I, serving as a core component for the formation of the 400 kDa subcomplex that is essential for subsequent assembly steps . The assembly process follows a specific sequence:

  • Nuclear-encoded subunits NDUFS2 and NDUFS3 form intermediate 1

  • Addition of NDUFS7 and NDUFS8 creates intermediate 2

  • Incorporation of NDUFA9 yields intermediate 3

  • Intermediate 3 is anchored to the membrane by assembly factors NDUFAF3 and NDUFAF4

  • This membrane-bound intermediate combines with an MT-ND1-containing subcomplex to form the 400 kDa assembly intermediate

This 400 kDa subcomplex serves as a critical scaffold for the subsequent assembly of the complete complex I. Experimental evidence demonstrates that deficiency of MT-ND1 prevents normal complex I assembly, leading to degradation of other subunits . Notably, even small amounts of wild-type MT-ND1 can partially restore complex I assembly, indicating its essential structural role .

How do mutations in MT-ND1 affect complex I assembly and function?

Mutations in MT-ND1 can disrupt complex I assembly and function through several mechanisms:

  • Disruption of protein-protein interactions:

    • Some mutations alter electrostatic forces between MT-ND1 and other subunits like NDUFA1, preventing proper assembly

    • These disruptions can destabilize the early assembly intermediates of complex I

  • Protein stability and expression effects:

    • Mutations like m.3955G>A can interfere with MT-ND1 expression, reducing protein levels

    • Other mutations such as m.3946G>A (p.E214K) decrease protein stability, leading to rapid degradation

  • Assembly interference:

    • Frame-shift mutations like m.3571dupC can lead to complete loss of MT-ND1, preventing early assembly steps

    • Even when mutation loads are below threshold levels (85-93%), partial disruption of assembly can occur

  • Functional consequences:

    • Compromised complex I assembly results in decreased enzyme activity

    • Disrupted electron transport leads to increased ROS production

    • Impaired complex I affects the formation of supercomplexes (respirasomes), further compromising mitochondrial function

A key experimental observation is that ectopic expression of even small amounts of wild-type MT-ND1 can partially restore assembly and function in cells harboring MT-ND1 mutations, suggesting potential therapeutic approaches .

How does MT-ND1 contribute to the coupling mechanism between ubiquinone reduction and proton pumping?

MT-ND1's strategic position at the junction of hydrophilic and hydrophobic domains of complex I makes it particularly important for the long-range coupling mechanism between electron transfer and proton pumping . Current understanding suggests:

  • Structural contribution:

    • MT-ND1 forms part of the ubiquinone binding domain

    • It also contributes to the structure of proton channels

    • Its positioning facilitates conformational changes that connect these two functional domains

  • Mechanistic hypotheses:

    • Ubiquinone reduction may induce conformational changes in MT-ND1

    • These changes could propagate to the membrane domain, triggering proton translocation

    • Specific residues in MT-ND1 may be critical for this signal transduction

  • Research challenges:

    • The precise coupling mechanism remains incompletely understood

    • Different mutations in MT-ND1 can have variable effects on coupling efficiency

    • Some mutations may affect ubiquinone binding but not proton pumping, or vice versa

This complex relationship explains why different MT-ND1 mutations can lead to distinct biochemical and clinical phenotypes, ranging from isolated complex I deficiency to more complex mitochondrial disorders .

How do mutations in MT-ND1 contribute to Leber hereditary optic neuropathy (LHON)?

Mutations in MT-ND1 account for approximately 13% of Leber hereditary optic neuropathy (LHON) cases, with the G3460A mutation being particularly common . The pathogenic mechanism involves:

  • Biochemical consequences:

    • Disruption of normal complex I activity in the mitochondrial inner membrane

    • Altered generation of ATP through oxidative phosphorylation

    • Increased production of reactive oxygen species (ROS) within mitochondria

  • Tissue specificity:

    • Despite MT-ND1 being expressed in all tissues with mitochondria, effects are largely limited to the optic nerve

    • This tissue specificity may relate to the high energy demands of retinal ganglion cells

    • Local factors in the optic nerve may exacerbate the consequences of mild complex I dysfunction

  • Clinical characteristics:

    • The G3460A mutation is associated with moderately severe vision loss

    • 20-40% of patients with this mutation experience some spontaneous visual recovery

    • Additional genetic and environmental factors likely influence disease expression

Experimental approaches to study LHON mechanisms include:

  • Cybrids (cells with patient mitochondria in a controlled nuclear background)

  • Animal models expressing MT-ND1 mutations

  • Patient-derived induced pluripotent stem cells differentiated to retinal ganglion cells

What experimental models are most effective for studying MT-ND1 mutations in cancer metabolism?

MT-ND1 has significant implications for cancer metabolism, particularly regarding the Warburg effect and hypoxia adaptation. Optimal experimental models include:

  • Cell line models:

    • Complex I-null osteosarcoma cells complemented with allotopically expressed MT-ND1

    • Comparison of isogenic cell lines with and without functional MT-ND1

    • Metabolic profiling under normoxic and hypoxic conditions

  • In vivo tumor models:

    • Xenografts of cells with manipulated MT-ND1 expression in nude mice

    • Assessment of tumor growth rate, invasion, and metastatic potential

    • Evaluation of hypoxia levels via pimonidazole staining and HIF-1α expression

  • Analytical approaches:

    • Transcriptomic profiling using techniques like 454-pyrosequencing

    • Metabolomic analysis to track glycolytic shift and TCA cycle intermediates

    • Assessment of oxygen consumption rates and extracellular acidification

Research has demonstrated that functional complex I is required for the glycolytic shift during hypoxia response and induction of the Warburg metabolic profile both in vitro and in vivo . This effect is mediated through HIF-1α stabilization, which is regulated by the balance between α-ketoglutarate and succinate following recovery of NADH consumption after complex I rescue .

Interestingly, severe MT-ND1 mutations may confer anti-tumorigenic properties, contrary to mutations in other mitochondrial tumor suppressor genes, highlighting the potential prognostic value of such genetic markers in cancer .

How can researchers design experiments to distinguish primary from secondary effects of MT-ND1 mutations?

Distinguishing primary from secondary effects of MT-ND1 mutations requires careful experimental design:

  • Time-course experiments:

    • Monitor changes immediately following induction of MT-ND1 expression or disruption

    • Track the temporal sequence of biochemical, transcriptional, and phenotypic changes

    • Early changes are more likely to represent primary effects

  • Rescue experiments:

    • Complement MT-ND1 mutations with wild-type allotopically expressed protein

    • Test partial rescue with alternative NADH dehydrogenases

    • Compare effects of rescuing complex I activity versus specific MT-ND1 protein-protein interactions

  • Isolated biochemical systems:

    • Reconstitute minimal systems with purified components

    • Test direct biochemical effects in the absence of cellular compensation mechanisms

    • Compare with results from intact cellular systems

  • Multi-omics approaches:

    • Integrate transcriptomics, proteomics, and metabolomics data

    • Apply network analysis to distinguish direct consequences from adaptive responses

    • Use computational modeling to predict primary effects based on known MT-ND1 functions

  • Heteroplasmy manipulation:

    • Generate cybrid cells with controlled levels of mutant mtDNA

    • Determine threshold effects for different phenotypes

    • Correlate mutation load with specific biochemical and cellular outcomes

How can allotopic expression of MT-ND1 be optimized for mitochondrial disease research?

Allotopic expression—expressing mitochondrially-encoded genes from the nuclear genome—represents a promising approach for studying and potentially treating MT-ND1-related disorders. Optimization strategies include:

  • Codon optimization protocols:

    • Replace mitochondrial codons with nuclear equivalents while maintaining amino acid sequence

    • Optimize codon usage based on the target cell type's nuclear genome preference

    • Remove potentially inhibitory sequences that might impair nuclear expression

  • Mitochondrial targeting enhancements:

    • Test different mitochondrial targeting sequences for optimal import efficiency

    • Include 5'-UTR sequences from nuclear-encoded mitochondrial proteins like COX10 to target mRNA to the mitochondrial outer membrane

    • Add 3'-UTR sequences to enhance mRNA stability and localization

  • Expression system considerations:

    • Select appropriate vectors based on required expression levels and duration

    • Consider inducible expression systems to control timing and levels

    • Evaluate viral versus non-viral delivery methods for different applications

  • Verification strategies:

    • Design PCR primers spanning the junction between targeting sequences and the recoded gene to specifically detect allotopic transcripts

    • Use antibodies against the native protein or subtle epitope tags

    • Assess functional integration through complex I activity assays and assembly analysis

Successful allotopic expression has been demonstrated using constructs containing COX10 5'-UTR and 3'-UTR regions, along with an N-terminal mitochondrial targeting sequence . This approach has enabled complementation of MT-ND1 mutations and restoration of complex I function in cellular models.

What are the most effective approaches for studying the role of MT-ND1 in mitochondrial supercomplexes?

MT-ND1 not only functions within complex I but also influences the formation of higher-order mitochondrial supercomplexes that enhance respiratory efficiency. Advanced research approaches include:

  • Structural biology techniques:

    • Cryo-electron microscopy of intact supercomplexes

    • Cross-linking mass spectrometry to identify interaction points

    • Computational modeling of supercomplex assembly involving MT-ND1

  • Dynamic assembly analysis:

    • Pulse-chase labeling to track the kinetics of supercomplex formation

    • Live-cell imaging with fluorescently tagged components

    • Time-resolved proteomics following induction of MT-ND1 expression

  • Functional assessments:

    • Substrate channeling efficiency between complexes

    • ROS production in various supercomplex configurations

    • Respiratory efficiency with different MT-ND1 variants

  • Experimental manipulation approaches:

    • Controlled expression of wild-type versus mutant MT-ND1

    • Site-directed mutagenesis of specific MT-ND1 residues predicted to affect supercomplex interactions

    • Lipid environment modifications to assess membrane-dependent assembly

Research has shown that mutations in MT-ND1 can disrupt the assembly of CI+CIII₂+CIV and CI+CIII₂ supercomplexes, affecting the formation of complete respirasomes . This disruption represents an important mechanism by which MT-ND1 mutations may impair mitochondrial function beyond their effects on complex I alone.

How can researchers accurately model the impact of heteroplasmic MT-ND1 mutations?

Mitochondrial DNA mutations, including those in MT-ND1, often exist in heteroplasmic states where wild-type and mutant mtDNA coexist within cells. Accurately modeling heteroplasmy presents unique challenges:

  • Generation of controlled heteroplasmic models:

    • Cybrid technology to introduce defined mixtures of wild-type and mutant mitochondria

    • CRISPR-based approaches for targeted mitochondrial genome editing

    • Inducible expression systems with variable wild-type:mutant ratios

  • Heteroplasmy threshold determination:

    • Systematic analysis of biochemical phenotypes across heteroplasmy levels

    • Identification of critical thresholds for different cellular functions

    • Comparison of threshold effects in different cell types and tissues

  • Single-cell analysis techniques:

    • Single-cell sequencing to capture heteroplasmy distribution within populations

    • Correlating single-cell phenotypes with mutation loads

    • Tracking heteroplasmy drift over time in dividing cells

  • Mathematical modeling approaches:

    • Stochastic modeling of mitochondrial segregation during cell division

    • Prediction of heteroplasmy threshold effects on metabolic networks

    • Simulation of selective pressures on different heteroplasmy levels

Research has identified threshold effects for specific MT-ND1 mutations, such as m.3571insC, which must exceed 85-93% heteroplasmy to result in complete loss of MT-ND1 protein . Below this threshold, partial function may be maintained, which has significant implications for disease progression and potential therapeutic interventions.

What are the most promising research directions for understanding MT-ND1 function in normal physiology and disease?

Future research on MT-ND1 should focus on several promising directions:

  • Structural biology:

    • High-resolution structures of MT-ND1 within complex I in different functional states

    • Detailed mapping of interaction interfaces with other subunits

    • Conformational changes during the catalytic cycle

  • Tissue-specific effects:

    • Comprehensive analysis of why MT-ND1 mutations affect specific tissues

    • Investigation of tissue-specific interaction partners or regulatory mechanisms

    • Development of tissue-specific disease models

  • Therapeutic development:

    • Refinement of allotopic expression approaches for potential gene therapy

    • Small molecule screens for compounds that can stabilize or bypass defective MT-ND1

    • Metabolic interventions to compensate for MT-ND1 dysfunction

  • Systems biology integration:

    • Network-level understanding of how MT-ND1 defects propagate through cellular systems

    • Multi-omics approaches to comprehensively map adaptive responses

    • Computational modeling to predict intervention points

The continued study of MT-ND1 will not only advance our understanding of mitochondrial biology but also potentially lead to therapeutic approaches for mitochondrial disorders such as LHON, MELAS, and certain cancers where mitochondrial function plays a crucial role .

How should researchers approach contradictory findings regarding MT-ND1 in the scientific literature?

When faced with contradictory findings regarding MT-ND1 in the scientific literature, researchers should:

  • Systematic comparisons of experimental systems:

    • Evaluate differences in model systems (cell lines, tissues, organisms)

    • Compare heteroplasmy levels in studies of MT-ND1 mutations

    • Assess differences in experimental conditions (culture media, oxygen levels, etc.)

  • Methodological analysis:

    • Examine differences in technical approaches and their limitations

    • Consider sensitivity and specificity of different assays

    • Evaluate statistical approaches and sample sizes

  • Replication studies:

    • Design experiments that directly test contradictory findings

    • Include positive and negative controls that distinguish between hypotheses

    • Collaborate with laboratories reporting contradictory results

  • Integrated hypothesis development:

    • Formulate models that might explain seemingly contradictory observations

    • Consider context-dependent effects of MT-ND1

    • Develop experimental approaches to test unified hypotheses

For example, contradictions regarding the role of MT-ND1 in cancer (tumor-promoting versus anti-tumorigenic) might be resolved by considering the specific mutation type, heteroplasmy level, cancer type, and metabolic context in which the studies were conducted.

What interdisciplinary approaches might yield new insights into MT-ND1 biology?

Interdisciplinary approaches that could advance MT-ND1 research include:

  • Computational biology and artificial intelligence:

    • Machine learning to predict effects of novel MT-ND1 mutations

    • Molecular dynamics simulations of conformational changes

    • Network analysis to identify non-obvious connections to other cellular systems

  • Advanced imaging technologies:

    • Super-resolution microscopy of MT-ND1 within intact mitochondrial networks

    • Correlative light and electron microscopy to connect functional and structural data

    • Live-cell imaging with activity-sensitive probes

  • Systems medicine approaches:

    • Integration of clinical data with basic research findings

    • Personalized modeling of patient-specific MT-ND1 mutations

    • Development of biomarkers for disease progression and treatment response

  • Synthetic biology strategies:

    • Design of minimal respiratory chain systems incorporating MT-ND1

    • Engineering of alternative electron transport pathways

    • Development of optogenetic tools to control MT-ND1 function

  • Evolutionary biology perspectives:

    • Comparative analysis of MT-ND1 across species with different metabolic demands

    • Investigation of positive selection signatures in MT-ND1 sequences

    • Exploration of co-evolution between mitochondrial and nuclear-encoded complex I subunits

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.