MT-ND4L is a core subunit of mitochondrial Complex I (NADH:ubiquinone oxidoreductase), which catalyzes the transfer of electrons from NADH to ubiquinone while pumping protons across the mitochondrial membrane . The recombinant protein corresponds to the full-length sequence (1–98 amino acids) of the native mitochondrial gene MT-ND4L (UniProt ID: Q70XH7) .
| Property | Value |
|---|---|
| EC Number | 1.6.5.3 |
| Molecular Weight | ~10,767 Da |
| Mitochondrial Localization | Inner mitochondrial membrane (transmembrane protein) |
Electron Transport: Facilitates proton pumping and ATP synthesis .
Enzyme Stability: Contributes to the structural integrity of Complex I .
| Species | Expression Host | Tag | Purity | Source |
|---|---|---|---|---|
| Caenolestes fuliginosus | Cell-free system | N/A | >85% (SDS-PAGE) | |
| Canis lupus | E. coli | His-tag | >90% (SDS-PAGE) |
Cell-Free Systems: Used for Caenolestes fuliginosus MT-ND4L to avoid host-specific modifications .
Storage: Lyophilized or glycerol-stabilized formulations prevent degradation .
MT-ND4L serves as a tool for studying mitochondrial dysfunction and disease mechanisms:
Mitochondrial Disorders: Investigating Complex I deficiencies linked to neurodegeneration and metabolic disorders .
Structural Biology: Mapping transmembrane domains to understand proton-pumping mechanisms .
Mitochondrial Gene Barcoding Insights:
While MT-ND4L is not a primary barcoding gene (unlike CO1), its short length (294 bp) and variability make it less effective for species identification compared to longer genes like ND4 (1,431 bp) .
MT-ND4L (mitochondrially encoded NADH dehydrogenase 4L) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). The protein from Caenolestes fuliginosus consists of 98 amino acids with a molecular weight of approximately 10.8 kDa. The amino acid sequence is: MASIYLNLMMAFLLALSGVLIYRSHLMSTLLCLEGMMLSLFIMMTLTISHFQMFSLSMAPLILLVFSACEAGIGLALLVKTSNAHGNDHVQNLNLLQC .
It functions in the transfer of electrons from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor. As part of Complex I, MT-ND4L participates in creating an unequal electrical charge across the inner mitochondrial membrane, which drives ATP production during oxidative phosphorylation .
MT-ND4L is a multi-pass transmembrane protein embedded in the inner mitochondrial membrane. Research methodologies to study its integration include:
Hydropathy plot analysis to identify transmembrane domains
Protein topology mapping using protease accessibility assays
Fluorescence resonance energy transfer (FRET) analysis with labeled domains
Cryo-EM structural studies of Complex I
The highly hydrophobic nature of MT-ND4L (particularly evident in mitochondrially-encoded versions) contributes to its membrane integration and anchoring function in Complex I .
While the complete functional domain architecture hasn't been fully characterized for C. fuliginosus MT-ND4L specifically, comparative analysis with other species shows several conserved features:
Highly hydrophobic transmembrane regions
Conserved amino acid residues involved in proton pumping
Structural motifs that contribute to the core catalytic function
When comparing sequences across species including Canis lupus (MSMVYINIFLAFILSLMGMLVYRSHLMSSLLCLEGMMLSLFVMMSVTILNNHLTLASMMPI VLLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLQC) , Macaca hecki (MIPTYMNIMLAFTISLLGMLTYRSHLVASLLCLEGMMMSLFIMATLIASNTHFPLINIMPIILLVFAACEAAVGLALLISISNTYGLDYIHNLNLLQC) , and Distoechurus pennatus (MMPINLNLIMAFSLALIGALVYRSHLMSTLLCLEGMMLSLFIQMALLISHFHMFSMSMAPLILLVFSACEAGLGLALLVKTSSNYGNDYVQNLNLLQC) , there is notable conservation especially in the central region of the protein sequence.
For highly hydrophobic mitochondrial proteins like MT-ND4L, several expression systems can be considered:
Cell-free expression systems: These have proven effective for transmembrane proteins like MT-ND4L from C. fuliginosus . This approach bypasses potential toxicity to host cells and allows for direct incorporation into membrane-mimetic environments.
E. coli expression: When using bacterial systems, consider:
Using specialized E. coli strains designed for membrane protein expression (C41, C43)
Expressing with fusion partners to enhance solubility
Codon optimization for E. coli
Lower induction temperatures (16-20°C) to slow expression and allow proper folding
Yeast expression systems: For more complex eukaryotic post-translational modifications.
The tag placement is critical - typically an N-terminal His-tag is preferred as seen in currently available recombinant products .
Purification of highly hydrophobic proteins like MT-ND4L requires specialized approaches:
Detergent selection: Screen multiple detergents (DDM, LDAO, Fos-choline) for optimal extraction without denaturing the protein.
Affinity chromatography: Utilizing His-tag affinity as the initial purification step, with careful optimization of imidazole concentration in wash and elution buffers.
Size exclusion chromatography: As a polishing step to separate monomeric protein from aggregates.
Buffer optimization: Typically, Tris/PBS-based buffers with 50% glycerol at pH 8.0 provide stability .
A recommended reconstitution protocol: Briefly centrifuge the vial prior to opening, reconstitute in deionized sterile water to 0.1-1.0 mg/mL, and add 5-50% glycerol (final concentration) before aliquoting for long-term storage at -20°C/-80°C .
Due to its role in Complex I, assessing MT-ND4L functionality requires several approaches:
Structural assessment:
Circular dichroism (CD) spectroscopy to verify secondary structure
Limited proteolysis to assess proper folding
Native PAGE to examine oligomeric state
Functional assays:
Reconstitution into liposomes or nanodiscs with other Complex I components
NADH:ubiquinone oxidoreductase activity assays
Proton pumping assays using pH-sensitive fluorescent dyes
Interaction studies:
Pull-down assays with known Complex I interaction partners
Blue native PAGE to assess complex formation
Crosslinking studies to identify proximity relationships
Comparative sequence analysis between C. fuliginosus MT-ND4L and other species reveals interesting evolutionary patterns:
Sequence conservation: While there is variability in the N-terminal regions, the central and C-terminal domains show higher conservation, suggesting functional constraints.
Hydrophobicity profiles: When comparing with nuclear-encoded homologs (like in Chlamydomonas reinhardtii), mitochondrially-encoded versions typically show higher hydrophobicity .
Genus-specific features: Species-specific amino acid substitutions may relate to metabolic adaptations or environmental pressures.
A methodological approach for comparative analysis:
Multiple sequence alignment using MUSCLE or CLUSTALW
Hydropathy plot comparison using Kyte-Doolittle or similar algorithms
Evolutionary rate analysis using PAML
Mapping conserved residues onto available structural models
To investigate the impact of mutations in MT-ND4L:
Site-directed mutagenesis: Target specific residues based on disease-associated mutations or conserved regions.
Functional complementation studies: Express wild-type or mutant MT-ND4L in systems lacking endogenous expression to assess functional rescue.
Structural modeling: Use homology modeling based on available Complex I structures to predict the impact of mutations.
In vitro reconstitution: Reconstitute purified wild-type and mutant proteins with other Complex I components to measure activity differences.
RNA interference approaches: As demonstrated in Chlamydomonas studies, RNAi suppression of ND4L expression can reveal its importance in complex assembly .
The T10663C (Val65Ala) mutation in humans has been associated with Leber hereditary optic neuropathy. This mutation appears to disrupt the normal activity of Complex I in the mitochondrial inner membrane, affecting energy production in cells with high energy demands, particularly retinal ganglion cells .
Recombinant MT-ND4L provides several experimental approaches for mitochondrial disorder research:
In vitro modeling of mutations:
Generate recombinant proteins with disease-associated mutations
Compare biochemical properties with wild-type protein
Assess impact on Complex I assembly and function
Protein-protein interaction studies:
Identify altered interactions caused by pathogenic mutations
Map interaction domains critical for Complex I assembly
Drug screening platforms:
Develop assays using recombinant protein to screen for compounds that rescue mutant phenotypes
Test stabilizers of Complex I assembly
Structural studies:
Use purified recombinant protein for structural determination
Investigate conformational changes associated with mutations
LHON research using recombinant MT-ND4L requires specific methodological considerations:
Mutation modeling: The Val65Ala mutation associated with LHON occurs in a conserved region, suggesting functional importance. Researchers should:
Engineer this specific mutation in recombinant constructs
Compare multiple parameters (stability, assembly, activity)
Consider the effect in different cellular contexts
Tissue-specific effects: Although MT-ND4L functions in all cells with mitochondria, LHON primarily affects retinal ganglion cells. Research approaches should:
Investigate cell-type specific vulnerability factors
Examine interaction with retinal ganglion cell-specific proteins
Test in relevant cellular models (induced pluripotent stem cell-derived retinal cells)
Bioenergetic profiling:
Measure oxygen consumption rates
Assess membrane potential changes
Quantify ATP production in wild-type vs. mutant conditions
Due to its small size (98 amino acids) and hydrophobic nature, MT-ND4L presents unique challenges for structural biology:
Cryo-electron microscopy (cryo-EM):
Can reveal MT-ND4L position within the larger Complex I structure
Requires purification of intact Complex I
May identify conformational changes during catalysis
NMR spectroscopy:
Suitable for smaller proteins like MT-ND4L
Requires isotopic labeling of recombinant protein
Can provide dynamic information about protein movements
X-ray crystallography:
Challenging for membrane proteins but possible with crystallization chaperones
May require fusion partners or antibody fragments to aid crystallization
Benefits from lipidic cubic phase approaches for membrane proteins
Hydrogen-deuterium exchange mass spectrometry (HDX-MS):
Can provide information about protein dynamics and solvent accessibility
Identifies regions involved in protein-protein interactions
Useful for comparing wild-type and mutant conformations
Reconstitution of functional Complex I using recombinant components represents an advanced research application:
Component preparation:
Express and purify multiple Complex I subunits under native conditions
Verify individual component folding and stability
Use matched expression systems for compatible post-translational modifications
Membrane mimetic selection:
Nanodiscs provide a controlled lipid environment with defined size
Liposomes allow for functional assays monitoring proton pumping
Detergent micelles may be simpler but less physiologically relevant
Assembly protocol optimization:
Step-wise addition of components may be necessary
Monitor assembly using blue native PAGE
Verify formation of sub-complexes during the assembly process
Functional verification:
NADH:ubiquinone oxidoreductase activity measurements
Electron paramagnetic resonance (EPR) to detect iron-sulfur cluster incorporation
Proton pumping assays to confirm vectorial electron transport
Research in Chlamydomonas has shown that absence of ND4L prevents assembly of the 950-kDa whole Complex I and suppresses enzyme activity, highlighting its essential role in complex formation .
This represents a frontier research question in mitochondrial biology:
In organello translation systems:
Isolated mitochondria can incorporate exogenous recombinant proteins
Allow study of integration with endogenously expressed mitochondrial components
Split fluorescent protein approaches:
Tag MT-ND4L with one half of a split fluorescent protein
Tag candidate interaction partners with complementary half
Monitor assembly through fluorescence complementation
Proximity labeling methods:
Express MT-ND4L fused to enzymes like BioID or APEX2
Identify nearby proteins through biotinylation and mass spectrometry
Map the interaction network within the native mitochondrial environment
Comparative analysis of nuclear transfer events:
Some species like Chlamydomonas reinhardtii have transferred ND4L to the nuclear genome
Study adaptations that facilitate expression and proper targeting
Analyze changes in hydrophobicity and targeting sequences