Recombinant Caenorhabditis remanei Cytochrome c oxidase subunit 2 (cox-2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Caenorhabditis remanei Cytochrome c Oxidase Subunit 2 (COX-2)

Recombinant Caenorhabditis remanei COX-2 is a synthetic protein produced through bacterial expression systems, specifically engineered to study the structural and functional properties of cytochrome c oxidase subunit II. This protein is derived from the nematode species Caenorhabditis remanei and serves as a valuable tool for investigating mitochondrial electron transport mechanisms, oxidative phosphorylation, and related biochemical pathways .

Key Features

CharacteristicDetail
Source OrganismCaenorhabditis remanei (a nematode model organism)
Expression SystemE. coli
TagN-terminal His-tag for purification
LengthFull-length (1–230 amino acids)
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder stored at -20°C/-80°C

Production and Purification

Recombinant COX-2 is synthesized via heterologous expression in E. coli, leveraging bacterial systems for high-yield production. Key steps include:

  1. Cloning: The cox-2 gene (Q8SEM9) is inserted into an expression vector.

  2. Expression: Induced in E. coli cultures under optimized growth conditions.

  3. Purification:

    • Affinity Chromatography: His-tag enables Ni-NTA column binding.

    • Lyophilization: Freeze-dried for stability, stored with 6% trehalose to prevent aggregation .

Functional Role in Cytochrome c Oxidase

COX-2 is integral to Complex IV (cytochrome c oxidase), the terminal enzyme of the mitochondrial electron transport chain. Its primary roles include:

  • Electron Transfer: Facilitates electron delivery from cytochrome c to the catalytic subunit (COX1) via the CuA center .

  • Oxygen Reduction: Contributes to the formation of the bimetallic active site (heme A3 and CuB) in COX1, enabling O₂ reduction to H₂O .

Comparison with Human COX2

FeatureC. remanei COX-2Human COX2 (MT-CO2)
Gene LocationMitochondrial DNA (nematode)Mitochondrial DNA (human mtDNA)
Length230 aa227 aa (human)
Copper BindingCuA center (Cys196, Cys200, His204)CuA center (Cys196, Cys200, His204)
Disease RelevanceModel for nematode mitochondrial studiesLinked to Complex IV deficiency

Research Applications and Findings

Recombinant COX-2 is primarily used in:

  • Structural Studies: Crystallization and cryo-EM to resolve COX2’s role in Complex IV assembly .

  • Biochemical Assays: Kinetic analysis of electron transfer rates and oxygen consumption .

  • Disease Modeling: Investigating mitochondrial dysfunction in nematode models, with implications for human Complex IV deficiencies .

Challenges and Considerations

  • Heterologous Expression: E. coli lacks eukaryotic chaperones, potentially affecting proper folding .

  • Storage Stability: Repeated freeze-thaw cycles degrade protein integrity; aliquoting is recommended .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for customers.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cox-2; coII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Caenorhabditis remanei (Caenorhabditis vulgaris)
Target Names
cox-2
Target Protein Sequence
NNFFQGYNLLFQHSLFASYMDWFHAFNCSLLLGVLVFVTLLFGYLIFSTFYFKSKKIEYQ FGELLCSIFPTIILLMQMVPSLSLLYYYGLMNLDSNLTVKVTGHQWYWSYEYSDIPGLEF DSYMKSLDQLNLGEPRLLEVDNRCVIPCDTNIRFCITSADVIHAWALNSLSVKLDAMSGI LSTFSYSFPMVGVFYGQCSEICGANHSFMPIALEVTLLDNFKSWCFGTME
Uniprot No.

Target Background

Function

Recombinant Caenorhabditis remanei Cytochrome c oxidase subunit 2 (cox-2): A component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes collaborate to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis and transmembrane transport. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the CuA center of subunit 2 and heme A of subunit 1 to the binuclear center (BNC) in subunit 1. This BNC, composed of heme A3 and CuB, reduces molecular oxygen to two water molecules using four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.