Recombinant Caiman crocodilus NADH-ubiquinone oxidoreductase chain 4 (MT-ND4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. If you have specific format requirements, kindly indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please notify us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure all contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. To ensure long-term stability, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our proteins is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C, while lyophilized formulations can be stored for up to 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is decided during production. If you have a preferred tag type, please inform us, and we will prioritize its implementation in the development process.
Synonyms
MT-ND4; MTND4; NADH4; ND4; NADH-ubiquinone oxidoreductase chain 4; NADH dehydrogenase subunit 4; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Caiman crocodilus (Spectacled caiman) (Caiman sclerops)
Target Names
Target Protein Sequence
GLQLTSPLLTAWWFLACSTNMALPPTINLSGELTLITSLFSWLDITVFLTGLSAFATTTY TLYMFSSTQQGTLPPNIKPSSPSQTREHFLMLLHLLPSAGLATNPKLTAPQ
Uniprot No.

Target Background

Function
This protein represents a core subunit within the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is considered a crucial component of the minimal assembly required for enzymatic activity. Complex I plays a pivotal role in transferring electrons from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor for the enzyme.
Protein Families
Complex I subunit 4 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of MT-ND4 in mitochondrial function?

MT-ND4 (NADH-ubiquinone oxidoreductase chain 4) is a critical subunit of NADH dehydrogenase (ubiquinone), also known as Complex I of the electron transport chain . This complex represents the largest of the five respiratory complexes in the mitochondrial inner membrane and serves as the primary entry point for electrons into the respiratory chain . In its functional context, MT-ND4 contributes to the process of oxidative phosphorylation, where the energy from NADH oxidation drives proton pumping across the inner mitochondrial membrane to generate the proton gradient necessary for ATP synthesis.

The Caiman crocodilus MT-ND4 protein, like its homologs in other species, is part of the core hydrophobic domain that anchors Complex I in the membrane . As one of seven mitochondrially-encoded subunits (along with MT-ND1, MT-ND2, MT-ND3, MT-ND4L, MT-ND5, and MT-ND6), it forms part of the transmembrane region essential for proton translocation . The protein's hydrophobic nature is critical for maintaining the structural integrity of the complex within the lipid bilayer, enabling the coupling of electron transfer to proton pumping.

In experimental settings, researchers investigating MT-ND4 typically focus on its contribution to Complex I assembly, stability, and activity, as well as its role in mitochondrial dysfunction when mutated.

What structural characteristics define recombinant Caiman crocodilus MT-ND4?

The recombinant Caiman crocodilus MT-ND4 protein exhibits several key structural characteristics that researchers should be aware of when designing experiments:

Table 1: Structural Characteristics of Recombinant Caiman crocodilus MT-ND4

ParameterCharacteristicReference
Amino Acid SequenceGLQLTSPLLTAWWFLACSTNMALPPTINLSGELTLITSLFSWLDITVFLTGLSAFATTTYTLYMFSSTQQGTLPPNIKPSSPSQTREHFLMLLHLLPSAGLATNPKLTAPQ
Uniprot AccessionQ34076
Expression Region1-111 amino acids (partial)
Molecular WeightApproximately 52 kDa (full length)
Alternative NamesNADH dehydrogenase subunit 4
Gene SynonymsMTND4, NADH4, ND4
Enzymatic ActivityEC 1.6.5.3

The recombinant protein's amino acid sequence reveals its highly hydrophobic nature, consistent with its role as a transmembrane component of Complex I . Most notably, the protein contains multiple hydrophobic residues arranged in patterns typical of membrane-spanning α-helices . When working with this recombinant protein, researchers should consider these hydrophobic properties in their experimental design, particularly for solubilization and purification protocols.

The expression region indicated in the product description (1-111) suggests that the commercially available recombinant protein represents a partial sequence of the full-length protein, which is important to consider when planning functional studies .

How does MT-ND4 differ between Caiman crocodilus and other vertebrates?

Comparative analysis of MT-ND4 across vertebrate lineages reveals both conservation of functional domains and species-specific variations that reflect evolutionary divergence:

While the search results don't provide direct sequence comparisons between Caiman crocodilus MT-ND4 and other species, general principles of mitochondrial gene evolution suggest several expected patterns. MT-ND4, as a mitochondrially-encoded protein, typically evolves at a rate intermediate between highly conserved nuclear-encoded proteins and rapidly evolving mitochondrial genes like the control region.

In crocodilians specifically, mitochondrial genes have been studied for phylogenetic relationships. Crocodilians (including Caiman crocodilus) generally show slower rates of molecular evolution compared to other vertebrates, which may extend to their mitochondrial genes including MT-ND4 .

The unusual feature of gene overlap between MT-ND4 and MT-ND4L observed in human mitochondrial DNA (where the first three codons of MT-ND4 overlap with the last three codons of MT-ND4L) may also be present in Caiman crocodilus, representing a conserved genomic organization of mitochondrial genes across diverse vertebrates .

What are the optimal storage and handling protocols for recombinant Caiman crocodilus MT-ND4?

Proper storage and handling of recombinant Caiman crocodilus MT-ND4 is critical for maintaining protein stability and functionality in research applications. Based on manufacturer recommendations, the following protocols should be observed:

Storage Conditions:

  • Long-term storage: Store at -20°C for standard preservation, or at -80°C for extended storage periods

  • Working aliquots: Maintain at 4°C for up to one week maximum

  • Avoid repeated freeze-thaw cycles as they significantly compromise protein integrity

The recommended storage buffer for this recombinant protein consists of a Tris-based buffer with 50% glycerol, optimized specifically for this protein . The high glycerol content serves as a cryoprotectant to prevent freeze-damage to the protein structure.

When designing experiments with this protein, researchers should prepare small working aliquots to avoid repeated freezing and thawing of the stock solution. For each experimental series, thaw only the required amount and maintain working solutions at 4°C.

Due to the hydrophobic nature of MT-ND4, researchers might encounter solubility challenges in aqueous buffers. Consider using mild detergents or lipid nanodisc systems when incorporating this protein into functional assays to maintain its native conformation and activity.

Before each use, it is advisable to centrifuge the protein solution briefly to collect any precipitate that may have formed during storage, especially after thawing frozen stocks.

What experimental approaches are recommended for studying MT-ND4 interactions with other Complex I components?

Investigating the interactions between MT-ND4 and other components of Complex I requires specialized techniques that account for the hydrophobic nature of these proteins and their membrane-embedded context. Several methodological approaches are particularly valuable:

  • Reconstitution systems: Researchers can employ artificial membrane systems or nanodiscs to reconstitute MT-ND4 with other Complex I subunits . This approach allows for controlled assembly of the complex and evaluation of specific protein-protein interactions.

  • Cross-linking coupled with mass spectrometry: Chemical cross-linking followed by proteomic analysis can identify specific interaction sites between MT-ND4 and neighboring subunits . This technique is particularly valuable for mapping the three-dimensional arrangement of proteins within the complex.

  • Maquette-based approaches: As demonstrated in oxidoreductase research, artificial protein scaffolds (maquettes) can be designed to study specific interactions between Complex I components in simplified systems . These elementary 4-α-helical protein constructs provide a minimalist platform for investigating functional interactions without the complexity of the entire natural complex.

  • Co-immunoprecipitation with tagged variants: By introducing epitope tags to recombinant MT-ND4 and other Complex I subunits, researchers can perform co-immunoprecipitation experiments to identify binding partners and interaction dynamics.

  • Activity coupling assays: Functional reconstitution of MT-ND4 with other Complex I components allows for measurement of electron transfer and proton pumping activities, providing insights into how these proteins cooperate in energy transduction .

The maquette approach described in the literature represents a particularly promising strategy, as it allows for "emulating functions of natural enzymes in man-made constructs" without importing the "complex and obscure interactions common to natural proteins" . This can be especially valuable for isolating specific functional aspects of MT-ND4 activity.

How can researchers assess the integrity and functionality of purified MT-ND4?

Verifying the structural integrity and functional activity of purified recombinant MT-ND4 is essential for ensuring experimental reliability. Several complementary approaches are recommended:

  • Spectroscopic analysis: UV-visible spectroscopy can confirm the presence of properly folded protein and detect potential aggregation. For MT-ND4, as a component of the electron transport chain, spectroscopic methods can also assess the protein's ability to interact with electron carriers.

  • SDS-PAGE and Western blotting: These techniques verify protein purity, molecular weight (expected ~52 kDa for full-length MT-ND4), and immunoreactivity using specific antibodies .

  • Functional activity assays: Electron transfer activity can be measured using artificial electron acceptors such as ubiquinone analogs. For recombinant MT-ND4, these assays may require reconstitution with other Complex I components or artificial electron donors.

  • Circular dichroism (CD) spectroscopy: This technique provides information about the secondary structure content of the protein, which is particularly important for confirming that the hydrophobic MT-ND4 maintains its expected high α-helical content characteristic of membrane proteins .

  • Thermal stability assessment: Differential scanning fluorimetry or other thermal denaturation methods can evaluate protein stability under various conditions, helping optimize buffer compositions for experimental applications.

  • Lipid binding assays: Given MT-ND4's integral membrane nature, assessing its ability to associate with lipids can provide valuable information about structural integrity.

  • ELISA-based quantification: For accurate determination of protein concentration, enzyme-linked immunosorbent assays using specific antibodies against MT-ND4 can be employed .

Researchers should establish baseline measurements for properly functioning MT-ND4 to serve as positive controls in subsequent experiments, especially when investigating mutant variants or studying protein-protein interactions.

How can recombinant MT-ND4 be used to study mitochondrial disease mechanisms?

Recombinant Caiman crocodilus MT-ND4 represents a valuable tool for comparative studies of mitochondrial disease mechanisms, particularly those involving Complex I dysfunction. Several research applications demonstrate its utility:

  • Modeling disease-associated mutations: Researchers can introduce mutations in recombinant MT-ND4 that correspond to those identified in human mitochondrial diseases such as Leber's hereditary optic neuropathy (LHON), age-related macular degeneration (AMD), mesial temporal lobe epilepsy (MTLE), and aspects of cystic fibrosis that have been linked to MT-ND4 variants . The crocodilian protein can serve as an evolutionary comparison point to understand conservation of pathogenic mechanisms.

  • Comparative biochemistry approach: By comparing the biochemical properties of Caiman MT-ND4 with human MT-ND4, researchers can identify structural and functional elements that might confer different susceptibilities to oxidative damage or functional impairment under stress conditions.

  • Oxidoreductase function studies: Using techniques developed for studying oxidoreductase enzymes in artificial systems, researchers can incorporate MT-ND4 into maquette protein platforms to isolate and study specific aspects of electron transport and proton pumping that may be compromised in disease states .

  • Species-specific resilience factors: Crocodilians exhibit remarkable physiological adaptations, including tolerance to hypoxia, which may involve specialized functions of mitochondrial proteins like MT-ND4. Studying these adaptations could reveal protective mechanisms relevant to human mitochondrial diseases.

  • Cross-species complementation experiments: Introducing Caiman MT-ND4 into cellular models lacking functional human MT-ND4 can test functional conservation and identify species-specific differences in protein function that might inform therapeutic approaches.

The integration of recombinant Caiman MT-ND4 into such studies benefits from the elementary protein design strategies described in the literature, where simplified protein frameworks allow for "incisive tools for analyzing the degree of physical interdependence between domains within the maquette and expose the roles of individual amino acids in supporting structure-function relationships" .

What are the implications of the gene overlap between MT-ND4 and MT-ND4L for protein expression and function?

The unusual gene overlap observed between MT-ND4 and MT-ND4L in mitochondrial genomes represents a fascinating area for research, with several important implications for protein expression and function:

In the human mitochondrial genome, there is a 7-nucleotide gene overlap where the first three codons of MT-ND4 (5'-ATG CTA AAA-3' coding for Met-Leu-Lys) overlap with the last three codons of MT-ND4L (5'-CAA TGC TAA-3' coding for Gln-Cys-Stop) . This arrangement, where MT-ND4 starts in the +3 reading frame relative to MT-ND4L, creates an intriguing translational challenge.

While the search results don't explicitly confirm this overlap in Caiman crocodilus, mitochondrial gene organization tends to be conserved across vertebrates, suggesting a similar arrangement may exist. This overlap has several implications for researchers:

  • Translational coordination: The overlapping genes suggest coordinated expression of MT-ND4 and MT-ND4L, which may be functionally significant given that both proteins are components of the same respiratory complex (Complex I). This coordination might ensure stoichiometric production of these interacting subunits.

  • RNA processing mechanisms: The overlap necessitates sophisticated RNA processing mechanisms to ensure proper translation of both proteins. Research into the RNA processing mechanisms specific to crocodilian mitochondria could reveal evolutionary adaptations in mitochondrial gene expression.

  • Structural interactions: The evolutionary conservation of this overlap suggests functional significance, possibly related to direct structural interactions between the N-terminus of MT-ND4 and the C-terminus of MT-ND4L within assembled Complex I.

  • Expression of recombinant proteins: For researchers working with recombinant MT-ND4, understanding this overlap is critical for designing expression constructs that properly represent the native protein's N-terminus.

  • Evolutionary constraints: The maintenance of this overlap across diverse vertebrate lineages indicates strong selective pressure, suggesting functional importance beyond simple genome compaction.

These implications highlight the importance of considering genomic context when studying mitochondrial proteins like MT-ND4, especially when designing expression systems for recombinant protein production or interpreting functional studies.

How does the metabolic role of MT-ND4 relate to Caiman crocodilus physiological adaptations?

The metabolic functions of MT-ND4 as part of Complex I in the electron transport chain have important implications for the physiological adaptations observed in Caiman crocodilus:

Research on nesting female spectacled caimans (Caiman crocodilus) reveals significant metabolic adjustments during reproductive periods. The study demonstrated that "body condition and plasmatic concentrations of glucose, triglycerides, lactate and uric acid of nesting females were significantly different from those of non-nesting females and males in C. crocodilus" . These metabolic shifts likely involve adaptations in mitochondrial function, where MT-ND4 plays a crucial role.

The findings that "nest age and distance to water had a negative effect on female body condition in C. crocodilus" and that "female C. crocodilus attending older nests or nests built further away from permanent water bodies tended to have lower body condition" suggest specific energy management strategies during reproduction . Such strategies would necessarily involve optimized mitochondrial function, potentially through adaptations in proteins like MT-ND4.

Table 2: Physiological Parameters Related to Metabolic Adaptations in Caiman crocodilus

Physiological ParameterNesting FemalesNon-nesting FemalesMalesSignificance
Body conditionDecreased with nest ageHigher than nesting femalesHigher than nesting femalesIndicates metabolic cost of nesting
Glucose levelsAlteredBaselineBaselineSuggests different energy utilization
TriglyceridesAlteredBaselineBaselineIndicates lipid metabolism adaptation
LactateAlteredBaselineBaselineMay reflect anaerobic metabolism
Uric acidAlteredBaselineBaselineSuggests altered protein metabolism

These physiological adaptations point to the importance of efficient energy metabolism in Caiman crocodilus, particularly during reproductive periods. MT-ND4, as a key component of the electron transport chain in mitochondria, likely plays an essential role in these metabolic adaptations. This suggests that studies of recombinant Caiman crocodilus MT-ND4 could provide valuable insights into the molecular basis of these adaptive physiological responses.

The research indicates that "female C. crocodilus attending older nests or nests built further away from permanent water bodies tended to have lower body condition," suggesting that "the nesting strategy of C. crocodilus has a metabolic cost associated with nest attendance for nesting females, which appear to depend on accumulated energetic reserves during nest attendance" . This dependence on energy reserves would involve mitochondrial function and potentially specialized adaptations in mitochondrial proteins like MT-ND4.

What are common challenges in working with recombinant MT-ND4 and how can they be addressed?

Researchers working with recombinant Caiman crocodilus MT-ND4 face several technical challenges due to the protein's hydrophobic nature and functional complexity. Here are the most common issues and recommended solutions:

  • Protein solubility issues:

    • Challenge: MT-ND4 is highly hydrophobic as a transmembrane protein, often leading to aggregation in aqueous solutions.

    • Solution: Use appropriate detergents (mild non-ionic detergents like DDM or LMNG) or lipid nanodisc systems to maintain protein solubility. The storage buffer containing 50% glycerol helps prevent aggregation during storage .

  • Protein stability concerns:

    • Challenge: Membrane proteins like MT-ND4 can be unstable once removed from their native lipid environment.

    • Solution: Store at recommended temperatures (-20°C for regular storage, -80°C for extended periods) and avoid repeated freeze-thaw cycles . For working solutions, maintain at 4°C for no more than one week.

  • Functional assay development:

    • Challenge: Assessing the activity of isolated MT-ND4 is difficult as it normally functions as part of Complex I.

    • Solution: Consider using artificial electron acceptors or reconstituting with other Complex I components. The maquette approach described in the literature offers a promising strategy for studying isolated aspects of oxidoreductase function .

  • Expression system limitations:

    • Challenge: Expressing full-length MT-ND4 in heterologous systems can be challenging due to its hydrophobicity and mitochondrial origin.

    • Solution: Consider using specialized expression systems designed for membrane proteins, or focus on functional domains rather than the entire protein.

  • Protein quantification difficulties:

    • Challenge: Standard protein quantification methods may be inaccurate for highly hydrophobic proteins in detergent solutions.

    • Solution: Use methods less affected by detergents, such as amino acid analysis or specifically developed ELISA approaches with standards prepared in the same buffer conditions .

  • Tag interference:

    • Challenge: Tags used for purification may affect protein folding or function.

    • Solution: When possible, verify results with both tagged and untagged versions of the protein, or use cleavable tags. Note that "the tag type will be determined during production process" for commercially available recombinant MT-ND4 .

  • Buffer optimization:

    • Challenge: Finding optimal buffer conditions that maintain both protein stability and activity.

    • Solution: Systematic testing of buffer components, with particular attention to pH, salt concentration, and stabilizing additives. The commercially available protein is provided in a "Tris-based buffer, 50% glycerol, optimized for this protein" .

When troubleshooting these challenges, researchers should consider the approaches used in oxidoreductase research, where "elementary, structurally stable 4-α-helix protein monomers with a minimalist interior malleable enough to accommodate various light- and redox-active cofactors" have been developed to study specific aspects of oxidoreductase function .

What experimental controls are essential when studying recombinant MT-ND4 function?

When designing experiments to investigate the function of recombinant Caiman crocodilus MT-ND4, researchers should implement several critical controls to ensure reliable and interpretable results:

  • Protein integrity controls:

    • Positive control: Include properly folded, functional MT-ND4 (verified by activity assays) as a reference standard.

    • Negative control: Heat-denatured or chemically inactivated MT-ND4 to establish baseline for non-specific effects.

    • Implementation: Run SDS-PAGE and Western blot analysis before each experimental series to confirm protein integrity.

  • Activity assay controls:

    • System validation: Use well-characterized components of the electron transport chain with established activity profiles.

    • Inhibitor controls: Include specific Complex I inhibitors (e.g., rotenone, piericidin A) to confirm that observed activity is specifically related to MT-ND4 function.

    • Reference measurements: Establish baseline kinetic parameters using standard oxidoreductase assays.

  • Environmental condition controls:

    • Temperature stability: Test protein activity at different temperatures to establish optimal conditions and understand thermal stability.

    • pH range testing: Verify activity across relevant pH ranges to identify optimal conditions and physiological relevance.

    • Buffer composition: Systematically vary buffer components to identify those critical for maintaining protein activity.

  • Comparative species controls:

    • Evolutionary context: When possible, include MT-ND4 from other species (particularly human or other well-characterized vertebrates) for comparative analysis.

    • Functional conservation: Test whether Caiman MT-ND4 can functionally replace MT-ND4 from other species in reconstituted systems.

  • Structural integrity verification:

    • Spectroscopic analysis: Use circular dichroism or other spectroscopic methods to confirm proper secondary structure.

    • Binding partner interactions: Verify expected interactions with known binding partners or cofactors.

  • Experimental system controls:

    • Maquette approach validation: When using artificial protein scaffolds to study MT-ND4 function, include controls that validate the maquette system itself .

    • Reconstitution efficiency: For membrane protein reconstitution, include controls that quantify the efficiency of protein incorporation into membranes or nanodiscs.

When implementing these controls, researchers should consider the approach described for oxidoreductase studies, where "first-principle studies on the folding of repeating amino acid heptads of 4-α-helical bundles free of intended function" provide a framework that is "simple enough that the chemical functionalities of each amino acid are few and largely understood" . This methodological approach offers a rigorous foundation for studying MT-ND4 function in controlled experimental systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.