Recombinant Calcitonin receptor-like protein 1 (pdfr-1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the available format, please specify your requirements during order placement for preferential preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms are stable for 6 months at -20°C/-80°C, while lyophilized forms are stable for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
pdfr-1; seb-1; C13B9.4; Calcitonin receptor-like protein 1; Pigment dispersing factor neuropeptide receptor homolog 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-546
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
pdfr-1
Target Protein Sequence
MADATSPFNVSILDNSTKLSEMVESGWNVLASTSVQAFNEAMDVLEESYPLCKKMLDHNN LFPERDPNDTRIWCNATYDTVLCWPPTPANSSVTLQCPHMKGLDPNKNITKDCHVSGVWS GRNAGEMGPTLPGWTNFTMCYTDEVIYIMQNLNNESLTIAQEVARNARKLEFVGLGLSLV SLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGK TINTMPIVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFNSEPKLLPYFIAGYGIP LVHTMLWLLVVLIKKDFKVERCLGSYYLEPEFWILDGPRMAELVINLFFICNVIRVLYSK VRESNNTSEAGLKKSVKAAMMLLPLLGVPNIMQTIPFAPTRDNIMVFAVWTYTASFTYMY QGLMVASIYCFTNKEVNHVLKTFYARYRLLHKSQNELRRGSRSVASHYAAKNGTANASAP QTNNADEFGKLSPFPSRSKKGSDDSTTKLMKDAVMEEEKNANNNGYGSAGEMTPLREGSN RSTKSP
Uniprot No.

Target Background

Function
PDFR-1 is a G-protein coupled receptor for PDF neuropeptides, activated by PDF-1 and PDF-2 peptides, though less effectively by isoform c. Isoforms a and b are believed to activate G-alpha(s) proteins, increasing cAMP levels, while isoform c inhibits cAMP levels via G-alpha(i/o) proteins. PDFR-1 plays a role in locomotion, particularly mate-seeking behavior independent of nutritional status, and may also be involved in touch sensitivity.
Gene References Into Functions
  1. The PDFR-1 pathway functions in non-sex-specific neurons to produce a male-specific, goal-oriented exploratory behavior. PMID: 23143519
  2. The pdfr-1 mutant phenocopies the impaired locomotor behavior observed in the pdf-1 mutant. PMID: 22579613
Database Links

STRING: 6239.C13B9.4a.1

UniGene: Cel.22708

Protein Families
G-protein coupled receptor 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expression was observed in the mechanosensory neuron pairs PLM, ALM, FLP, OLQD, and OLQV, the chemosensory neurons PHA, PHB, RMEV, the ring motor neurons RMED, and the pharyngeal interneuron pair I1. In both hermaphrodites and males at the L4 stage expres

Q&A

What is pdfr-1 and what are its basic characteristics?

Pigment Dispersing Factor Receptor (PDFR-1) is a seven-transmembrane domain G protein-coupled receptor (GPCR) belonging to class B GPCRs. In Caenorhabditis elegans, it functions as a neuropeptide receptor that modulates neural circuits involved in sex-specific behaviors and physiological responses. The protein shares structural similarities with the calcitonin receptor-like receptor (CRLR) found in mammals . The full-length PDFR-1 protein consists of 546 amino acid residues and contains several functional domains including an extracellular N-terminal domain crucial for ligand binding .

PDFR-1 primarily functions by recognizing and binding the neuropeptide PDF-1, initiating downstream signaling cascades that regulate various physiological processes . Unlike many other receptors that are expressed in sex-specific neurons to generate sex-specific behaviors, the pdf-1/pdfr-1 pathway operates in neurons common to both sexes but produces sex-specific behavioral outputs .

How does the N-terminal domain of pdfr-1 contribute to ligand binding?

The N-terminal (Nt) extracellular region of pdfr-1, similar to other class B GPCRs, plays a critical role in ligand recognition and binding. Research indicates that the Nt-domain is an autonomously folded structural unit with well-defined secondary and tertiary structures that significantly contributes to ligand binding affinity .

For researchers studying pdfr-1, this indicates that experiments focusing on the N-terminal domain alone can provide valuable insights into ligand binding dynamics without necessarily requiring the entire receptor to be expressed.

What experimental approaches can verify proper folding of recombinant pdfr-1?

Verifying proper folding of recombinant pdfr-1 is critical for ensuring biological activity in functional studies. Several complementary biophysical techniques can be employed:

  • Circular Dichroism (CD) Spectroscopy: Far-UV CD spectra can reveal characteristic patterns of secondary structure elements (α-helices, β-sheets). Properly folded pdfr-1 N-terminal domain should display spectral features consistent with a structured protein rather than random coil conformations .

  • Fluorescence Spectroscopy: Intrinsic tryptophan fluorescence spectra provide information about the tertiary structure environment surrounding aromatic residues. Properly folded proteins typically show blue-shifted emission maxima compared to denatured proteins .

  • Size Exclusion Chromatography: This technique can confirm that recombinant pdfr-1 exists as a monodisperse, monomeric species rather than forming non-specific aggregates, which would indicate improper folding .

  • Ligand Binding Assays: Functional verification of proper folding can be demonstrated through specific binding to cognate ligands (e.g., PDF-1). Dose-dependent binding with physiologically relevant affinity constants strongly suggests native-like conformation .

These techniques should be used in combination rather than relying on a single method to comprehensively assess the folding state of recombinant pdfr-1.

Which expression systems are optimal for producing functional recombinant pdfr-1?

The choice of expression system significantly impacts the yield, folding, and functionality of recombinant pdfr-1. Based on available research data, the following expression systems have proven effective:

Bacterial Expression Systems (E. coli):
E. coli has been successfully used to express the N-terminal domain of related receptors like CRLR. When expressed in E. coli, the protein typically forms inclusion bodies that require refolding procedures to obtain soluble, functional protein . While this system offers high yield and cost-effectiveness, the refolding process can be challenging and may result in variable recovery of functional protein.

Mammalian Expression Systems:
For full-length pdfr-1 expression, mammalian cell lines like HEK-293 cells provide a more native-like environment with appropriate post-translational modifications and chaperone-assisted folding. This system is particularly valuable when studying receptor-ligand interactions in the context of functional assays .

The optimal choice depends on your specific research objectives:

  • For structural studies of isolated domains: E. coli expression with refolding

  • For functional and signaling studies: Mammalian expression systems

  • For high-throughput screening: Consider insect cell expression systems

How does the pdf-1/pdfr-1 signaling pathway modulate neural circuits in C. elegans?

The pdf-1/pdfr-1 signaling pathway in C. elegans regulates neural circuits in a sophisticated manner to produce context-dependent and sex-specific behaviors. This pathway exemplifies how neuropeptide signaling can integrate environmental cues with internal physiological states to modulate behavior.

In male C. elegans, pdf-1/pdfr-1 signaling modulates the circuit encoding reproductive drive, specifically promoting mate-searching behavior when males are deprived of mates . Mechanistically, this occurs through:

  • Regulation of reversal frequency: pdfr-1 mutant males display increased frequency of both reversals and high-angle turns (omega turns) compared to wild-type males, indicating that pdfr-1 normally suppresses these movements to promote forward exploration .

  • Integration with food-sensing pathways: The pdf-1/pdfr-1 pathway works in parallel with glutamatergic signaling (glr-1) to regulate the balance between food-seeking and mate-seeking behaviors. While glr-1 promotes reversals upon recent food experience, pdfr-1 suppresses reversals upon mate deprivation .

  • Sex-specific gene regulation: The pathway acts in a sex-specific manner to regulate the expression of genes like daf-7 in the ASJ neurons, affecting downstream sexually dimorphic behavioral programs .

The neuroanatomical basis for this regulation involves pdf-1 expression in the gender-shared interneuron AIM, while the receptor acts in environment-sensing neurons including URY, PQR, and PHA to produce mate-searching behavior . This demonstrates how a neuropeptide pathway can function in non-sex-specific neurons to generate sex-specific behavioral outputs.

What methodological approaches can be used to study pdfr-1 interactions with RAMPs?

Receptor activity-modifying proteins (RAMPs) are crucial for the functional expression and ligand specificity of many class B GPCRs. To study pdfr-1 interactions with RAMPs, researchers can employ several methodological approaches:

Co-immunoprecipitation (Co-IP):
This technique can identify physical interactions between pdfr-1 and candidate RAMPs. By using antibodies against either protein, researchers can precipitate complexes and analyze them via Western blotting to confirm associations .

Fluorescence Resonance Energy Transfer (FRET):
FRET provides information about protein-protein proximity in living cells. By tagging pdfr-1 and RAMPs with appropriate fluorophores, researchers can detect energy transfer when the proteins interact, allowing real-time visualization of these interactions.

Surface Expression Assays:
Cell surface biotinylation followed by streptavidin pull-down can quantify how RAMPs affect the trafficking of pdfr-1 to the plasma membrane. Alternatively, flow cytometry using antibodies against extracellular epitopes can measure surface expression levels .

Mutagenesis Studies:
Strategic mutations in pdfr-1 can identify critical residues mediating RAMP interactions. For example, studies with related receptors have shown that mutations like L94A can upregulate surface expression of receptor heterodimers to a greater degree than wild-type receptors .

Ligand Binding Specificity:
Functional assays measuring changes in ligand binding profiles when pdfr-1 is co-expressed with different RAMPs can reveal how these accessory proteins modulate receptor pharmacology. This approach has successfully demonstrated how RAMPs determine ligand specificity for related receptors like CRLR .

How do mutations in the pdf-1/pdfr-1 pathway affect sex-specific behaviors?

Mutations in the pdf-1/pdfr-1 pathway produce striking sex-specific behavioral phenotypes, particularly affecting male exploratory behaviors. These phenotypes provide valuable insights into the neural basis of sex-specific behaviors and decision-making processes.

Male-specific behavioral effects:

  • Mate-searching behavior: Both pdf-1 and pdfr-1 null mutant males are defective in leaving food to search for mates (Las phenotype), indicating they have lost their drive to explore away from a food source .

  • Locomotion patterns: pdfr-1 mutant males display increased frequency of reversals and high-angle turns compared to wild-type males, as well as slower movement on food due to decreased frequency of body bends .

  • Decision-making: The pathway regulates the balance between competing needs (food versus reproductive appetite), with mutants showing deficits in mate-seeking prioritization .

Intriguing aspects for researchers:

  • The slow movement phenotype can be genetically dissociated from the mate-searching defect, suggesting separate neural mechanisms .

  • While pdf-1/pdfr-1 mutants have defects in male-specific mate searching behavior, they retain normal pathogen avoidance behaviors, indicating pathway specificity .

  • Males with mutations in the food-searching pathway have a higher tendency to explore away from food than wild-type males, and this enhanced exploration depends on functional pdfr-1 .

These findings suggest that the pdf-1/pdfr-1 pathway functions as a key modulator of sex-specific motivational states, highlighting its potential as a model for studying how neuropeptide signaling contributes to context-dependent decision-making.

What experimental designs best capture the role of pdfr-1 in male reproductive drive?

To effectively study pdfr-1's role in male reproductive drive, experimental designs should capture the integration of sensory cues, internal states, and behavioral outputs. Based on previous research approaches, the following experimental designs are particularly effective:

1. Food-leaving assay (mate-searching paradigm):
This assay quantifies the probability of male worms leaving a food patch in the absence of mates. The experimental setup involves:

  • Placing individual males on a small bacterial lawn

  • Monitoring their position over 24 hours

  • Calculating the leaving probability as the proportion of animals that leave the lawn

2. Reversal frequency analysis:
This approach measures the frequency of direction-changing movements (reversals and omega turns) which are inversely correlated with exploratory behavior:

  • Record freely moving animals using automated tracking systems

  • Analyze movement patterns to quantify reversal events

  • Compare mutant and wild-type behavioral patterns under identical conditions

3. Genetic dissection through double mutant analysis:
Creating double mutants with genes in parallel pathways can reveal how pdfr-1 integrates with other decision-making circuits:

  • Combine pdfr-1 mutations with mutations affecting food-sensing pathways (e.g., glr-1)

  • Measure behavioral outputs in the double mutants compared to single mutants

  • Identify epistatic relationships and pathway interactions

4. Cell-specific rescue experiments:
These experiments pinpoint the precise neural substrates where pdfr-1 functions:

  • Express wild-type pdfr-1 in specific subsets of neurons in a pdfr-1 mutant background

  • Test for behavioral rescue in the food-leaving assay

  • Systematically map the minimal circuit required for normal behavior

5. Neural activity imaging:
Calcium imaging approaches can directly measure how pdfr-1 affects neural circuit activity:

  • Express calcium indicators in relevant neurons

  • Compare neural activity patterns between wild-type and pdfr-1 mutants

  • Correlate activity changes with behavioral transitions

These experimental designs collectively provide a multi-level analysis of how pdfr-1 regulates male reproductive drive, from molecular interactions to behavioral outputs.

How do structural variations in the N-terminal domain of pdfr-1 affect ligand specificity?

The N-terminal (Nt) domain of pdfr-1 and related receptors plays a crucial role in determining ligand binding specificity. Research on structurally similar receptors provides insights into how variations in this domain affect ligand interactions.

Studies with the calcitonin receptor-like receptor (CRLR) revealed that the Nt domain can bind ligands such as calcitonin gene-related peptide (CGRP) and adrenomedullin (AM) with high affinity even in isolation from the full receptor . This binding capability indicates that the Nt domain contains critical determinants for ligand recognition and specificity.

Specific structural elements within the Nt domain that affect ligand specificity include:

For researchers studying pdfr-1 variants, these insights highlight the importance of considering both direct binding interfaces and conformational effects when analyzing how structural variations affect ligand specificity.

What approaches can resolve contradictory data in pdfr-1 signaling studies?

When encountering contradictory data in pdfr-1 signaling studies, researchers should implement systematic troubleshooting and validation approaches to resolve discrepancies:

1. Validate protein expression and localization:

  • Confirm protein expression levels using quantitative Western blotting

  • Verify subcellular localization using immunofluorescence or tagged constructs

  • Ensure proper trafficking to the plasma membrane, especially when studying receptor-RAMP interactions

2. Examine experimental context differences:

  • Compare differences in model systems (e.g., cell lines, primary cultures, in vivo models)

  • Assess variations in physiological conditions (temperature, pH, ionic environment)

  • Consider developmental timing and cell-type specific effects, especially in C. elegans studies

3. Implement parallel methodological approaches:

  • Use multiple independent assays to measure the same phenomenon

  • For signaling studies, examine different readouts in the pathway (cAMP, Ca²⁺, ERK activation)

  • Combine genetic approaches with pharmacological interventions to cross-validate findings

4. Consider sex-specific effects:

  • The pdf-1/pdfr-1 pathway produces sex-specific outcomes despite functioning in shared neurons

  • Explicitly test for sex differences in all experimental paradigms

  • Analyze how sex-specific co-factors might modulate signaling outcomes

5. Examine functional redundancy:

  • Test for compensation by related signaling pathways

  • Create compound mutants to unmask phenotypes hidden by redundant mechanisms

  • Consider that pdfr-1 functions in parallel with other pathways (e.g., glr-1) for behavioral regulation

6. Control for genetic background effects:

  • Use multiple independent alleles of pdfr-1

  • Perform rescue experiments to confirm phenotype specificity

  • Backcross mutant strains to minimize background effects

By systematically applying these approaches, researchers can resolve contradictory data and develop a more coherent understanding of pdfr-1 signaling mechanisms.

How can single-cell approaches advance our understanding of pdfr-1 function?

Single-cell approaches offer unprecedented resolution for understanding how pdfr-1 functions within specific neurons and how it contributes to circuit-level properties. These techniques can reveal cell-specific expression patterns, signaling dynamics, and functional contributions that may be obscured in population-level analyses.

Single-cell RNA sequencing (scRNA-seq):
This technique can identify the precise cellular expression pattern of pdfr-1 and its co-factors across neural populations. By comparing transcriptional profiles between sexes or under different conditions, researchers can discover:

  • Cell types expressing both pdf-1 and pdfr-1

  • Co-expression patterns with RAMPs or other signaling components

  • Sex-specific transcriptional differences in pdfr-1-expressing cells

Single-cell calcium imaging:
Using genetically encoded calcium indicators expressed in specific neurons, researchers can monitor how pdfr-1 signaling affects neural activity at the single-cell level:

  • Real-time activity changes in response to PDF-1 application

  • Differences in signaling dynamics between wild-type and mutant cells

  • Cell-specific responses within interconnected circuits

CRISPR-based approaches:
CRISPR/Cas9 technology enables precise genetic manipulation at the single-cell level:

  • Generation of mosaic animals with cell-specific pdfr-1 knockout

  • Creation of knock-in reporters to visualize endogenous pdfr-1 localization

  • Introduction of point mutations to test structure-function relationships

Optogenetic manipulation:
Combining optogenetics with electrophysiology or behavioral analysis can reveal:

  • How acute activation of PDF-1 releasing neurons affects pdfr-1-expressing target cells

  • The temporal dynamics of pdfr-1-mediated responses

  • Circuit-level consequences of pathway activation in behaving animals

Single-cell proteomics:
Emerging single-cell proteomic technologies can identify:

  • Post-translational modifications of pdfr-1 in specific cells

  • Protein interaction networks in different cellular contexts

  • Differences in signaling complex assembly between sexes

These single-cell approaches collectively provide a multi-dimensional view of pdfr-1 function that bridges molecular mechanisms with circuit properties and behavioral outputs.

What purification strategies yield highest activity for recombinant pdfr-1?

Obtaining high-activity recombinant pdfr-1 requires carefully optimized purification strategies that preserve the protein's native conformation. Based on successful approaches with similar receptors, the following strategies are recommended:

For E. coli expression systems:
When expressed in E. coli, pdfr-1 (particularly the N-terminal domain) typically forms inclusion bodies that require refolding. A successful purification protocol involves:

  • Inclusion body isolation and solubilization:

    • Lyse cells using sonication or mechanical disruption

    • Wash inclusion bodies with detergent-containing buffers to remove contaminants

    • Solubilize using chaotropic agents (6-8M urea or 6M guanidinium hydrochloride)

  • Refolding strategies:

    • Dilution method: Slowly dilute denatured protein into refolding buffer

    • Dialysis: Gradually remove denaturant through dialysis against decreasing concentrations

    • On-column refolding: Immobilize denatured protein on affinity resin before refolding

  • Chromatographic purification:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged proteins

    • Size exclusion chromatography to separate monomeric protein from aggregates

    • Ion exchange chromatography for final polishing

Key factors affecting functional recovery:

ParameterOptimal ConditionsImpact on Activity
Refolding buffer pH7.5-8.5Critical for disulfide bond formation
Redox systemGSH/GSSG (5:1 ratio)Facilitates correct disulfide pairing
AdditivesL-arginine (0.4-0.8M)Prevents aggregation during refolding
Temperature4°CReduces hydrophobic aggregation
Protein concentration<0.1 mg/mLHigher concentrations promote aggregation

Activity verification:
The functionality of purified pdfr-1 should be confirmed using:

  • Ligand binding assays using labeled peptides (e.g., 125I-labeled PDF-1)

  • Competitive binding assays with unlabeled ligands

  • Structural characterization via circular dichroism and fluorescence spectroscopy

These strategies, when carefully optimized for pdfr-1, can yield protein preparations with high specific activity suitable for structural studies, binding assays, and antibody production.

How can researchers effectively study interactions between pdfr-1 and its ligands?

Studying the interactions between pdfr-1 and its ligands requires specialized techniques that can detect binding events, measure binding parameters, and characterize the functional consequences of these interactions. The following methodological approaches are particularly effective:

1. Radioligand binding assays:
These assays remain the gold standard for quantifying receptor-ligand interactions with high sensitivity:

  • Direct binding: Use radiolabeled ligands (e.g., 125I-labeled PDF-1) to measure total binding

  • Competition binding: Displace labeled ligand with increasing concentrations of unlabeled competitors

  • Saturation binding: Determine Bmax (receptor density) and Kd (affinity)

2. Surface plasmon resonance (SPR):
SPR provides real-time, label-free detection of binding kinetics:

  • Immobilize purified pdfr-1 (or its N-terminal domain) on a sensor chip

  • Flow ligands at various concentrations over the surface

  • Measure association (kon) and dissociation (koff) rate constants

  • Calculate equilibrium dissociation constant (KD = koff/kon)

3. Fluorescence-based techniques:
These approaches offer advantages for studying binding dynamics:

  • Fluorescence polarization: Detect changes in the rotational mobility of fluorescently labeled ligands upon binding

  • FRET: Measure energy transfer between fluorophores on the receptor and ligand

  • Microscale thermophoresis: Quantify binding by measuring changes in thermophoretic mobility

4. Functional assays:
To connect binding events with downstream signaling:

  • cAMP accumulation assays: Measure changes in intracellular cAMP levels following receptor activation

  • Ca2+ mobilization assays: Monitor changes in intracellular calcium using fluorescent indicators

  • Reporter gene assays: Quantify activation of downstream signaling pathways

5. Computational approaches:

  • Molecular docking: Predict binding modes and interaction energies

  • Molecular dynamics simulations: Examine conformational changes upon ligand binding

  • Structure-activity relationship (SAR) analysis: Correlate structural features with binding affinity

6. Structural biology techniques:

  • X-ray crystallography of receptor-ligand complexes

  • Cryo-electron microscopy for larger complexes

  • NMR spectroscopy for detecting binding interfaces

By combining multiple approaches, researchers can develop a comprehensive understanding of how pdfr-1 interacts with its ligands and how these interactions trigger downstream signaling events.

What are the critical quality control parameters for recombinant pdfr-1 production?

Ensuring consistent quality of recombinant pdfr-1 preparations is essential for reliable research outcomes. The following quality control parameters should be systematically evaluated:

1. Purity assessment:

  • SDS-PAGE with Coomassie or silver staining: Should show a single predominant band at the expected molecular weight

  • Western blotting: Confirms identity using specific antibodies

  • Mass spectrometry: Provides precise molecular weight and can detect post-translational modifications

  • Analytical size exclusion chromatography: Quantifies aggregate content

2. Structural integrity:

  • Circular dichroism (CD) spectroscopy: Confirms proper secondary structure formation

  • Fluorescence spectroscopy: Assesses tertiary structure through intrinsic tryptophan fluorescence

  • Thermal shift assays: Measures protein stability and can identify stabilizing buffer conditions

3. Functional characterization:

  • Ligand binding assays: Determine binding affinity (Kd) and capacity (Bmax)

  • Competitive displacement: Confirms specificity of binding site

  • Dose-response curves: Measure EC50 values for functional activation

4. Batch consistency parameters:

ParameterAcceptable RangeMethod
Protein concentration±10% of targetBradford/BCA assay
Endotoxin level<1 EU/mg proteinLAL assay
Aggregation<5%Size exclusion HPLC
Specific activity>80% of referenceBinding inhibition assay
pH±0.2 unitspH meter
AppearanceClear, colorlessVisual inspection

5. Storage stability:

  • Accelerated stability studies at elevated temperatures

  • Repeated freeze-thaw cycle testing

  • Long-term storage at -80°C with periodic activity testing

6. Contaminant testing:

  • Host cell protein content: ELISA-based assays

  • DNA contamination: qPCR-based assays

  • Proteolytic degradation: Western blotting with N- and C-terminal antibodies

By implementing these quality control measures, researchers can ensure that variations in experimental outcomes reflect biological phenomena rather than inconsistencies in protein quality. This is particularly important when studying subtle effects of mutations or when comparing results across different experimental systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.