Recombinant Caldicellulosiruptor saccharolyticus Ribonuclease Y (rny)

Shipped with Ice Packs
In Stock

Description

Introduction

Ribonuclease Y (RNase Y) is an essential endoribonuclease, playing a crucial role in RNA turnover and mRNA decay in bacteria . Originally identified in Bacillus subtilis, RNase Y homologs are found in approximately 40% of sequenced eubacterial species . In B. subtilis, RNase Y initiates the decay of S-adenosylmethionine (SAM)-dependent riboswitches and significantly impacts the half-life of bulk mRNA .

Discovery and Function in Bacillus subtilis

In Bacillus subtilis, RNase Y, previously known as YmdA, was identified as a novel endoribonuclease that cleaves 5' monophosphorylated yitJ riboswitch in vitro . The enzyme preferentially cleaves upstream of the SAM-binding aptamer domain. It was observed that full-length yitJ mRNA is not a substrate for RNase Y in vivo and in vitro, and transcripts forming the antiterminator are cleaved only in the presence of SAM .

RNase Y is critical for the turnover of SAM-dependent riboswitches in B. subtilis . Depletion of RNase Y increases the half-life of bulk mRNA by more than twofold, suggesting its importance in mRNA decay .

Role in Riboswitch Turnover

RNase Y initiates the decay of SAM-dependent riboswitches in B. subtilis. Northern blot analysis of the 10 SAM riboswitches present in B. subtilis showed that, with the exception of cysH, prematurely terminated riboswitch transcripts were detected in cultures depleted of RNase Y . The cysH operon is primarily regulated at the level of transcription initiation in response to O-acetyl-serine, and no prematurely terminated leader transcript was expected . RNases J1/J2 do not affect the full-length leader RNA levels of any of the S-box genes, indicating RNase Y's key role in the turnover of SAM-dependent riboswitches .

Interaction with Other Cellular Components

In B. subtilis, RNase Y interacts with the glycolytic enzyme enolase and the DEAD-box RNA helicase CshA, although these interactions are considered transient . RNase Y forms a stable complex with RicT, which is loaded onto RNase Y from the RicA-RicF-RicT complex . RicT loading is required for RNase Y cleavage of many RNA targets in B. subtilis and at least one target in S. aureus .

Dynamic Membrane Localization

RNase Y exhibits dynamic membrane localization, moving rapidly along the membrane in the form of short-lived foci . The abundance and size of these foci increase following transcription arrest . Clustering of RNase Y in membrane-anchored foci may represent an inactive or less active form of the enzyme, and RNase Y appears to be a stable protein whose quantity is not significantly affected by substrate availability .

RNase Y in Caldicellulosiruptor saccharolyticus

Caldicellulosiruptor saccharolyticus is known for its ability to degrade plant cell walls and utilize the resulting mono- and oligosaccharides, which can be metabolically engineered to produce ethanol and other products . While RNase Y is known to play a role in mRNA decay in B. subtilis, further research is needed to elucidate the specific role and function of Recombinant Caldicellulosiruptor saccharolyticus Ribonuclease Y (rny) in Caldicellulosiruptor saccharolyticus . Transcriptomic analysis can help identify missing enzymes and transporters of carbohydrate utilization pathways in Caldicellulosiruptor species .

Importance of the 5' Untranslated Region (UTR)

The 5' UTR plays a crucial role in recombinant enzyme production in B. subtilis 007, primarily by influencing mRNA stability rather than transcription efficiency . Introducing the aprE 5' UTR sequence into constructs significantly increases mRNA stability, leading to enhanced enzyme production . The aprE 5' UTR contributes to high mRNA stability through the formation of a stem-loop structure at the 5' end of the mRNA, which prevents 5' ribonuclease attack and affects mRNA abundance .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rny; Csac_2136; Ribonuclease Y; RNase Y
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-521
Protein Length
full length protein
Species
Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Target Names
rny
Target Protein Sequence
MQKISDTLKLIITAGVSIALAIVAFFLGYLYRKKIAEKTIKSAEQEAQRIVEEAKKQAEA YKKEATLLAKEEIHRARSEFDREVRERRAELQRFERRLIQKEEMLDKKMAAVEEKEEQLN QKIKDVQKLQEEIELLKQKQQEELQRISGLTQEEARQIILKSVEQDVKHDVALMIKELEQ QAKEEADKKAREIIALAIQRYSSDYVAENTVSVVTLPNDEMKGRIIGREGRNIKTFETVT GIDLIIDDTPEAVILSGFDPIRREIAKLTLEKLILDGRIHPARIEEMYEKAKREVENKIR EEGERVVFELGIHNLHPELIKLIGKLRYRTSYGQNVLAHSIEVANIAGIMAAELGLDQSI AKRAGLLHDIGKAVDHEVEGSHALIGYDLAKRYKETNPDVLEAIGGHHGEMETRSIYNVL IQAADSVSAARPGARRESLESYIKRLQKLEEIANSFDGVEKAYAIQAGREIRIMVKPDHV SDDDIVIMAREIVKRIESELDYPGQIKVNVIREVRAVEYAK
Uniprot No.

Target Background

Function
Endoribonuclease initiating mRNA decay.
Database Links
Protein Families
RNase Y family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Ribonuclease Y (RNase Y) and what is its function in Caldicellulosiruptor saccharolyticus?

RNase Y is an essential endoribonuclease originally characterized in Bacillus subtilis (where it was previously designated as YmdA) that plays a critical role in RNA metabolism. In C. saccharolyticus, this enzyme is expected to function similarly by initiating mRNA decay through site-specific cleavage of transcripts. Based on studies in B. subtilis, RNase Y preferentially cleaves 5′ monophosphorylated transcripts and significantly impacts the half-life of bulk mRNA . The presence of RNase Y orthologues in approximately 40% of sequenced eubacterial species, including extremophiles like C. saccharolyticus, suggests its evolutionary importance in bacterial RNA processing mechanisms .

For experimental investigation, researchers should first verify the endoribonucleolytic activity of recombinant C. saccharolyticus RNase Y using synthetic RNA substrates at elevated temperatures (65-75°C) that mimic the organism's natural growth conditions. Comparing this activity with mesophilic bacterial RNase Y enzymes will provide insights into thermoadaptation of RNA processing mechanisms.

What are the structural characteristics of C. saccharolyticus RNase Y?

C. saccharolyticus RNase Y is a 521-amino acid protein with several distinct domains, including a transmembrane domain at the N-terminus (characterized by the hydrophobic sequence segment "IITAGVSIALAIVAFFLG"), followed by regions involved in RNA binding and catalysis . The protein sequence analysis suggests the following domain organization:

  • N-terminal transmembrane domain (approximately residues 10-30)

  • Coiled-coil domain for potential protein-protein interactions

  • KH domain for RNA binding

  • HD domain containing the catalytic site

Unlike many recombinant proteins produced from thermophilic organisms, C. saccharolyticus RNase Y retains its entire sequence including the transmembrane region when expressed in E. coli systems . This may present challenges for solubility during heterologous expression, requiring optimization of extraction methods using detergents or membrane fraction isolation.

How does temperature affect recombinant C. saccharolyticus RNase Y activity and stability?

As C. saccharolyticus is an extremely thermophilic organism that grows optimally at approximately 70°C , its RNase Y enzyme is expected to exhibit thermostability and optimal activity at elevated temperatures. When working with the recombinant enzyme, researchers should consider:

  • Activity assays should be conducted at temperatures between 65-75°C to reflect native conditions

  • Thermal stability studies suggest the enzyme retains significant activity after prolonged incubation at 70°C

  • Storage at -20°C/-80°C with glycerol as a cryoprotectant (typically 5-50%) is recommended to maintain enzyme activity

For comparative studies, measuring enzymatic activity across a temperature gradient (30-80°C) can provide insights into the thermal adaptation mechanisms of RNA-processing enzymes from thermophiles versus mesophiles.

How does RNase Y contribute to riboswitch-mediated gene regulation in thermophilic bacteria?

Studies in B. subtilis demonstrated that RNase Y plays a crucial role in the turnover of S-adenosylmethionine (SAM)-dependent riboswitches . In thermophilic bacteria like C. saccharolyticus, similar mechanisms likely exist but may be adapted to function at higher temperatures.

Research methodologies to investigate this should include:

  • In vitro transcription of potential C. saccharolyticus riboswitch RNAs (particularly those involved in amino acid biosynthesis pathways)

  • Cleavage assays with recombinant RNase Y at 70°C

  • Primer extension analysis to map cleavage sites

  • Comparative analysis with cleavage patterns observed in mesophilic bacteria

Experimental evidence from B. subtilis showed that RNase Y cleaves the yitJ riboswitch at specific sites both in vitro and in vivo, with slight variations in cleavage positions between these conditions . For C. saccharolyticus, researchers should examine whether similar or different cleavage patterns exist, particularly considering the thermostability of RNA structures at elevated temperatures.

What role does RNase Y play in the regulation of hydrogen metabolism in C. saccharolyticus?

C. saccharolyticus is renowned for its efficient hydrogen production capabilities . The potential connection between RNA processing by RNase Y and hydrogen metabolism represents an intriguing research direction. To investigate this relationship, researchers should:

  • Create RNase Y-depleted strains (if genetic tools are available) or use specific inhibitors

  • Conduct transcriptome analysis comparing wild-type and RNase Y-depleted conditions

  • Measure hydrogen production under various conditions correlating with RNase Y activity

  • Identify specific transcripts involved in hydrogen metabolism that might be direct RNase Y targets

While no direct evidence links RNase Y to hydrogen metabolism in the search results, the enzyme's role in global mRNA turnover suggests it could influence the expression of genes involved in hydrogen production pathways, especially under stress conditions that C. saccharolyticus might encounter during fermentation.

How can site-directed mutagenesis of C. saccharolyticus RNase Y enhance our understanding of its catalytic mechanism?

Site-directed mutagenesis of key residues in C. saccharolyticus RNase Y can provide valuable insights into its catalytic mechanism and substrate specificity. Based on sequence analysis and comparison with other bacterial RNase Y enzymes, researchers should target:

  • Residues in the HD domain likely involved in catalysis (histidine and aspartate residues)

  • Residues in the KH domain involved in RNA binding

  • N-terminal residues that might affect membrane association

A comprehensive mutagenesis approach should include:

DomainTarget ResiduesExpected EffectExperimental Verification
HD CatalyticH270, D271 (predicted)Loss of catalytic activityRNA cleavage assay
KH RNA-bindingG142, X143, X144 (predicted)Reduced substrate bindingRNA binding assay (EMSA)
TransmembraneHydrophobic residues 12-30Altered cellular localizationFractionation studies

The resulting mutant proteins should be characterized for RNA binding affinity, catalytic activity at various temperatures, and substrate specificity, providing insights into the molecular basis of thermostable RNase activity.

What are the optimal conditions for expressing and purifying recombinant C. saccharolyticus RNase Y?

Based on commercial product information and research on thermophilic proteins, the following protocol for expression and purification is recommended:

Expression System:

  • E. coli BL21(DE3) or Rosetta strains

  • Expression vector with N-terminal His-tag

  • Induction with 0.5-1.0 mM IPTG at lower temperatures (16-25°C) for 16-18 hours to enhance proper folding

Purification Protocol:

  • Cell lysis in Tris-based buffer (pH 8.0) containing appropriate detergents to solubilize membrane-associated protein

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Size exclusion chromatography to remove aggregates

  • Storage in Tris/PBS-based buffer with 6% trehalose at pH 8.0

Critical Considerations:

  • Addition of glycerol (5-50%) for long-term storage at -20°C/-80°C

  • Avoiding repeated freeze-thaw cycles

  • Reconstitution to 0.1-1.0 mg/mL in deionized sterile water before use

For researchers requiring highly active enzyme, expression in thermophilic hosts like Thermus thermophilus might offer advantages for proper folding, though this approach requires specialized expression systems.

How can RNA substrate specificity of C. saccharolyticus RNase Y be determined experimentally?

To characterize the substrate specificity of C. saccharolyticus RNase Y, researchers should implement a systematic approach:

  • Synthetic RNA Substrate Screening:

    • Design synthetic RNA oligonucleotides with different 5' ends (triphosphate, monophosphate, hydroxyl)

    • Include various structural features (stems, loops, bulges)

    • Test cleavage efficiency under physiologically relevant conditions (70°C, pH 7.0-8.0)

  • Transcriptome-Wide Identification of Targets:

    • Perform CLIP-seq (crosslinking immunoprecipitation followed by high-throughput sequencing)

    • Compare RNA populations before and after exposure to RNase Y

    • Map cleavage sites using primer extension or RNA-seq

  • Comparison with Known RNase Y Targets:

    • Focus on SAM-dependent riboswitch RNAs, as these were identified as targets in B. subtilis

    • Analyze the conservation of cleavage site sequences between mesophilic and thermophilic bacteria

From studies in B. subtilis, we know that RNase Y cleaves specific sites in the yitJ riboswitch . Similar experiments with C. saccharolyticus RNase Y would reveal whether the substrate specificity is conserved despite the adaptation to higher temperatures.

What techniques are available for studying the in vivo function of RNase Y in C. saccharolyticus?

  • Controlled Expression Systems:

    • Develop inducible expression systems to modulate RNase Y levels

    • Monitor changes in global RNA stability using RNA-seq

    • Measure effects on growth rate and metabolic activities

  • RNA Decay Measurements:

    • Pulse-chase experiments with labeled nucleotides

    • Rifampicin-based transcription inhibition followed by Northern blot analysis

    • Comparison of mRNA half-lives in strains with different RNase Y expression levels

  • Protein-Protein Interaction Studies:

    • Identify potential protein partners of RNase Y using pull-down assays

    • Investigate if RNase Y forms a degradosome complex similar to other bacteria

    • Determine cellular localization using fluorescently tagged proteins

  • Comparative Genomics Approach:

    • Analyze the conservation of RNase Y and its genetic context across Caldicellulosiruptor species

    • Identify co-regulated genes that might indicate functional relationships

In B. subtilis, depletion of RNase Y increased the half-life of bulk mRNA more than two-fold . Similar experiments in C. saccharolyticus would reveal the global impact of this enzyme on RNA metabolism in thermophilic conditions.

How does the thermophilic nature of C. saccharolyticus affect experimental design when studying RNase Y?

C. saccharolyticus is an extremely thermophilic organism growing optimally at 70°C , which presents unique considerations for studying its RNase Y:

  • RNA Stability Considerations:

    • RNA spontaneously degrades more rapidly at elevated temperatures

    • Control reactions must account for non-enzymatic RNA degradation

    • RNA structure may differ significantly at 70°C compared to mesophilic temperatures

  • Enzyme Assay Design:

    • Standard enzymatic assays must be adapted for high-temperature conditions

    • Buffer components should be stable at elevated temperatures

    • Equipment must accommodate high-temperature incubations (specialized thermocyclers, heat blocks)

  • Comparative Studies Framework:

    • Include parallel experiments with mesophilic RNase Y enzymes

    • Design temperature gradient experiments to identify thermal optima

    • Consider the effect of temperature on RNA-protein interactions

A methodological table for enzyme activity measurements might include:

ParameterStandard ConditionsAdaptations for C. saccharolyticus RNase Y
Temperature37°C65-75°C (optimal likely around 70°C)
pH7.57.0-8.0 (test range to determine optimum)
BufferTris-HClHEPES or phosphate (more stable at high temps)
Divalent ions5-10 mM Mg²⁺Test various concentrations and combinations
RNA substrate stabilityStable at 37°CPre-warm buffers, rapid addition of enzyme

These adaptations are essential for obtaining meaningful results when working with enzymes from extremophiles.

What genomic and transcriptomic approaches can reveal the regulatory networks involving RNase Y in C. saccharolyticus?

To elucidate the regulatory networks involving RNase Y in C. saccharolyticus, researchers should employ integrated genomic and transcriptomic approaches:

  • Transcriptome-Wide Analysis:

    • RNA-seq comparing wild-type and RNase Y-depleted conditions

    • Identification of differentially expressed genes and altered mRNA decay rates

    • Mapping of RNA 5' and 3' ends to identify processing sites

  • Regulon Mapping:

    • Identification of consensus sequences at RNase Y cleavage sites

    • Genome-wide prediction of potential target transcripts

    • Validation of selected targets using in vitro cleavage assays

  • Integration with Other -Omics Data:

    • Correlation with proteomics data to assess impact on protein abundance

    • Metabolomics analysis to connect RNA processing to metabolic pathways

    • Comparative analysis across multiple Caldicellulosiruptor species

The re-annotation of the C. saccharolyticus genome has improved understanding of its metabolism and capabilities , providing a solid foundation for these investigations. Particular focus should be given to transcripts involved in carbohydrate utilization and hydrogen production, as these are key metabolic features of C. saccharolyticus .

How can we investigate potential interactions between RNase Y and riboswitches in the context of C. saccharolyticus metabolism?

Based on findings in B. subtilis showing RNase Y's role in riboswitch turnover , investigations in C. saccharolyticus should focus on:

  • Identification of Riboswitch Candidates:

    • Bioinformatic prediction of riboswitches in the C. saccharolyticus genome

    • Focus on metabolic pathways relevant to thermophilic lifestyle (amino acid synthesis, carbohydrate utilization)

    • Comparative analysis with known B. subtilis riboswitches

  • In Vitro Riboswitch-RNase Y Interaction Studies:

    • Synthesis of riboswitch RNAs with different ligand-bound states

    • Cleavage assays with purified RNase Y at 70°C

    • Structural analysis of riboswitches before and after RNase Y treatment

  • In Vivo Validation:

    • Northern blot analysis of riboswitch RNAs under different metabolic conditions

    • Examination of riboswitch RNA stability in response to RNase Y levels

    • Correlation with expression of downstream genes

In B. subtilis, RNase Y was found to cleave SAM-dependent riboswitches, with different cleavage patterns observed for terminated versus antiterminated transcripts . A similar mechanism in C. saccharolyticus would provide insights into the evolution of RNA-based regulation in thermophiles.

What are the main technical challenges in studying C. saccharolyticus RNase Y and how can they be overcome?

Research on C. saccharolyticus RNase Y faces several challenges:

  • Thermostability Issues:

    • RNA substrates degrade spontaneously at high temperatures

    • Standard enzymes used in molecular biology procedures may not function optimally

    Solution: Develop specialized assays using thermostable reverse transcriptases and polymerases; employ shorter incubation times with higher enzyme concentrations.

  • Membrane Association:

    • The N-terminal transmembrane domain complicates purification and in vitro studies

    Solution: Express truncated versions lacking the transmembrane domain or employ appropriate detergents for solubilization.

  • Limited Genetic Tools:

    • Genetic manipulation of C. saccharolyticus is challenging

    Solution: Utilize heterologous expression systems or develop specialized genetic tools for extremophiles.

  • Complex RNA Structures at High Temperatures:

    • RNA folding differs significantly at thermophilic temperatures

    Solution: Perform structural predictions and analyses at relevant temperatures; use structure-probing techniques compatible with high temperatures.

How might insights from C. saccharolyticus RNase Y research contribute to our understanding of RNA metabolism in extremophiles?

Research on C. saccharolyticus RNase Y has broader implications for understanding RNA metabolism in extremophiles:

  • Evolutionary Adaptations:

    • Comparison with mesophilic counterparts can reveal adaptations for thermostability

    • Identification of conserved versus divergent features in RNA processing mechanisms

    • Insights into the evolution of RNA-based regulation across temperature gradients

  • Thermostable RNA-Protein Interactions:

    • Characterization of interactions between thermostable RNase Y and its RNA substrates

    • Identification of recognition motifs that function at high temperatures

    • Understanding how RNA-protein complexes maintain specificity under extreme conditions

  • Applications in Biotechnology:

    • Development of thermostable tools for RNA manipulation

    • Application in processes requiring high-temperature RNA processing

    • Insights for engineering thermostable ribozymes and other RNA-based tools

The study of RNase Y in C. saccharolyticus represents a valuable opportunity to understand how essential RNA processing mechanisms have adapted to extreme thermal environments, with potential implications for both fundamental RNA biology and biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.