Recombinant Caldicellulosiruptor sp. Putative ABC transporter permease protein ORF1

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Caldicellulosiruptor sp. Putative ABC Transporter Permease Protein ORF1

Caldicellulosiruptor sp. Putative ABC transporter permease protein ORF1 is a protein encoded by the ORF1 gene in Caldicellulosiruptor species . It is identified as a putative ATP-binding cassette (ABC) transporter permease protein (ABCTPP) . ABC transporters are a superfamily of proteins involved in the transport of various molecules across cell membranes .

Key Features and Characteristics

  • Basic Information Caldicellulosiruptor sp. Putative ABC transporter permease protein ORF1 is a protein that, based on Pfam analysis, is speculated to be an ABC transporter permease. It contains conserved domains for the MacB-like periplasmic core domain and the FtsX-like permease family .

  • Structural Predictions STRING functional assignment predicts the protein as an ABC transporter containing transmembrane domains (TMD) and ATP Binding domains (NBD) . HMMTOP analysis has predicted three transmembrane helices within ORF1 at positions 202–224, 255–274, and 295–318, suggesting its TMD structure . NsitePred has identified strong nucleotide-binding sites (predominantly ATP Binding) between positions 59–60 and 104–107 of ORF1, which could be the NBD .

  • Functional Insights The predicted NBD is known to generate energy for the transport of toxic molecules through TMDs .

  • Recombinant Protein Details Recombinant forms of this protein are often produced in E. coli with a His tag for purification and identification . The full-length protein typically consists of 140 amino acids .

  • Sequence The amino acid sequence for Caldicellulosiruptor sp. Putative ABC transporter permease protein ORF1 is: DPNVAFYSVVAVICWQYIPFYMIFFIAALSNIPQELYEAAKIDGATQGQYFWRIELPLLT PSIKTACILSLIGSLKYFDLIYVMTEGGPSNATELMATYMYKNAFASFKMGYGSTIASAM FLIITTAGIFAYFVTRRKEE .

Production and Sourcing

  • Expression Hosts The recombinant protein can be expressed in various hosts, including E. coli and Yeast .

  • Available Forms The protein is available as a lyophilized powder .

  • Purity Generally, the purity is greater than 90% as determined by SDS-PAGE .

  • Applications Suitable for SDS-PAGE and ELISA .

Potential Functions and Role

  • Transport As an ABC transporter permease, this protein is likely involved in the transport of molecules across the cell membrane . ABC transporters are known for transporting a variety of substrates, including nutrients, ions, and drugs .

  • Detoxification The protein may play a role in the efflux of toxic substances from the cell, contributing to cellular detoxification mechanisms .

  • Cellular Processes Involved in several pathways and plays different roles in them .

Table of features for Recombinant Full Length Caldicellulosiruptor Sp. Putative Abc Transporter Permease Protein Orf1 Protein, His-Tagged

FeatureDescription
Cat.No.RFL26032CF
Product OverviewRecombinant Full Length Caldicellulosiruptor sp. Putative ABC transporter permease protein ORF1 Protein (P40979) (1-140aa), fused to N-terminal His tag, was expressed in E. coli.
SpeciesCaldicellulosiruptor sp.
SourceE.coli
TagHis
Protein LengthFull Length (1-140)
FormLyophilized powder
AA SequenceDPNVAFYSVVAVICWQYIPFYMIFFIAALSNIPQELYEAAKIDGATQGQYFWRIELPLLT PSIKTACILSLIGSLKYFDLIYVMTEGGPSNATELMATYMYKNAFASFKMGYGSTIASAM FLIITTAGIFAYFVTRRKEE
PurityGreater than 90% as determined by SDS-PAGE.
ApplicationsSDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Gene NameCaldicellulosiruptor sp. Putative ABC transporter permease protein ORF1
SynonymsPutative ABC transporter permease protein ORF1; Fragment
UniProt IDP40979

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
Putative ABC transporter permease protein ORF1; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Caldicellulosiruptor sp. (strain Rt8B.4)
Target Protein Sequence
DPNVAFYSVVAVICWQYIPFYMIFFIAALSNIPQELYEAAKIDGATQGQYFWRIELPLLT PSIKTACILSLIGSLKYFDLIYVMTEGGPSNATELMATYMYKNAFASFKMGYGSTIASAM FLIITTAGIFAYFVTRRKEE
Uniprot No.

Target Background

Function
May play a role in sugar transport.
Protein Families
Binding-protein-dependent transport system permease family, MalFG subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Caldicellulosiruptor and why is it significant for research?

Caldicellulosiruptor represents a genus of extremely thermophilic, cellulolytic bacteria that are remarkable for their ability to degrade lignocellulosic biomass without conventional pretreatment . Caldicellulosiruptor bescii, the most extensively studied species of the genus, has a growth optimum at 78°C and holds the distinction of being the most thermophilic cellulose degrader currently known . The genus has gained significant attention in research due to its potential biotechnological applications, particularly in biomass conversion for sustainable energy production . The recent taxonomic development has separated some species into the Anaerocellum genus, with C. bescii now formally recognized as Anaerocellum bescii in some literature . These organisms are attractive targets for metabolic engineering, but successful applications require comprehensive understanding of their primary metabolic pathways and transport mechanisms .

What are ABC transporters and what role do they play in Caldicellulosiruptor species?

ATP-binding cassette (ABC) transporters are membrane-bound molecular pumps that form one of the largest protein families across all domains of life . In Caldicellulosiruptor species, these transporters play crucial roles in substrate uptake, particularly for oligosaccharides derived from cellulose and hemicellulose degradation . The general architecture of ABC transporters comprises two hydrophilic nucleotide-binding domains (NBDs) and two hydrophobic transmembrane domains (TMDs) that create a substrate pathway across the cellular membrane . The NBDs bind and hydrolyze ATP, providing the energy necessary for conformational changes that drive substrate translocation through the TMDs . In Anaerocellum bescii (formerly C. bescii), genomic analyses have identified at least twenty-three ABC sugar transporters, highlighting their importance in the organism's carbohydrate metabolism .

How is ORF1 defined in the context of Caldicellulosiruptor ABC transporters?

Based on the recent research published in 2025, the putative ABC transporter permease protein ORF1 likely corresponds to one of the transmembrane domain proteins in the cello-oligosaccharide transport system identified in Anaerocellum bescii . Specifically, this may refer to one of the proteins encoded by the Athe_0595-0596 loci, which form the transmembrane domains of the ABC transporter system dedicated to cello-oligosaccharide uptake . These transmembrane domains function in conjunction with two extracellular substrate-binding proteins (Athe_0597 and Athe_0598) and are powered by a promiscuous ATPase (Athe_1803) . The complete ABC transporter locus (Athe_0595-0598) appears widely conserved across both Anaerocellum and Caldicellulosiruptor genera, though with some variation between species .

What is the molecular mechanism of ABC transporters in Caldicellulosiruptor species?

The molecular mechanism of ABC transporters in Caldicellulosiruptor involves a coordinated sequence of conformational changes driven by ATP binding and hydrolysis . When ATP binds to the NBDs, it induces dimerization and conformational changes that are transmitted to the TMDs, including the permease proteins . Molecular dynamics simulations of similar ABC transporters have revealed that the TMDs regulate ATP hydrolysis by controlling conformational transitions of the NBD helical domains .

The catalytic cycle begins with substrate binding to extracellular binding proteins like Athe_0597 and Athe_0598, which then dock with the transmembrane domains . This interaction triggers ATP hydrolysis at the NBDs, which causes conformational changes in the TMDs that translocate the substrate across the membrane . The Q-loop, identified as a key element in the NBD mechanism, plays a critical role in coordinating these conformational changes . In Anaerocellum bescii, the system appears to use a shared promiscuous ATPase (Athe_1803) to power multiple oligosaccharide transporters, as deletion of this ATPase inhibits growth on cello-oligosaccharides .

What are the substrate specificity patterns of the binding proteins associated with the ABC transporter permease?

Recent biophysical analyses using Differential Scanning Calorimetry (DSC) and Isothermal Titration Calorimetry (ITC) have revealed distinct substrate specificity patterns for the two binding proteins associated with the cello-oligosaccharide ABC transporter in Anaerocellum bescii . The binding protein Athe_0597 demonstrates broad specificity, binding cello-oligosaccharides of varying lengths (G2-5) with micromolar dissociation constants . In contrast, Athe_0598 shows much narrower specificity, binding only cellobiose among the tested substrates .

Detailed ITC experiments revealed the following binding parameters:

Binding ProteinSubstrateAssociation Constant (Kₐ)Binding Affinity
Athe_0597Cellobiose (G2)Highest (order of magnitude higher)Highest affinity
Athe_0597Cellotriose (G3)Lower than G2High affinity
Athe_0597Cellotetraose (G4)Lower than G2High affinity
Athe_0597Cellopentaose (G5)Lower than G2High affinity
Athe_0598Cellobiose (G2)Detectable bindingSpecific binding
Athe_0598G3-G5, GlucoseNo binding detectedNo affinity

This differential substrate specificity suggests a sophisticated system for selective transport of different cello-oligosaccharides, with Athe_0597 serving as a generalist transporter and Athe_0598 functioning as a specialist for cellobiose uptake .

How does the cellular localization of recombinant ABC transporter proteins affect their functionality?

The cellular localization of recombinant ABC transporter proteins significantly impacts their functionality, particularly in heterologous expression systems. Studies with CelA protein in C. bescii have demonstrated that protein transport across the membrane is associated with post-translational modifications, specifically glycosylation . When CelA was expressed with and without its signal sequence in C. bescii, researchers observed that extracellular CelA protein was glycosylated whereas intracellular CelA was not . This suggests either that protein transport is required for this post-translational modification or that glycosylation is required for protein export .

By extension, the proper localization of ABC transporter components, including the permease proteins, is likely critical for their functionality. The permease domains (such as those encoded by Athe_0595-0596) must be correctly inserted into the membrane to form the transmembrane channel, while the substrate-binding proteins (Athe_0597-0598) must be positioned extracellularly to capture substrates . Genetic deletion studies with the MACB1080 and HTAB187 strains have demonstrated that disruption of this ABC transporter locus significantly impacts growth on cello-oligosaccharides, confirming its essential role in substrate utilization .

What are the optimal expression systems for producing recombinant Caldicellulosiruptor ABC transporter proteins?

The optimal expression systems for recombinant Caldicellulosiruptor ABC transporter proteins should consider both the extreme thermophilic nature of these proteins and their complex membrane integration requirements. Recent advances have shown that homologous expression in Caldicellulosiruptor species themselves can be advantageous for certain proteins . For instance, researchers successfully expressed the CelA protein in C. bescii using a newly constructed expression vector, which allowed the production of significant quantities of full-length, active protein in vivo in the native host .

For heterologous expression, careful consideration must be given to the host system. While Escherichia coli is commonly used, challenges with protein solubility have been reported when expressing Caldicellulosiruptor proteins in this system . Studies focused on improving solubility of Clostridium thermocellum proteins (another thermophilic genus) expressed in E. coli may provide valuable insights for Caldicellulosiruptor proteins as well .

When expressing membrane proteins like ABC transporter permeases, additional factors to consider include:

  • Codon optimization for the host organism

  • Temperature adjustments for proper folding

  • Addition of solubility tags or fusion partners

  • Use of specialized strains with enhanced membrane protein expression capabilities

  • Consideration of post-translational modifications like glycosylation

What biophysical methods are most effective for characterizing the structure-function relationship of Caldicellulosiruptor ABC transporter permeases?

Multiple complementary biophysical approaches have proven effective for characterizing the structure-function relationships of ABC transporters from thermophilic organisms. Based on the research data, the following methods have yielded valuable insights:

  • Differential Scanning Calorimetry (DSC): This technique has been successfully used to analyze thermal stability and binding interactions of the substrate-binding proteins associated with ABC transporters in Anaerocellum bescii . DSC can detect thermal transition (Tm) shifts upon substrate binding, providing initial evidence of specific interactions .

  • Isothermal Titration Calorimetry (ITC): ITC provides quantitative measurements of binding parameters, including dissociation constants (Kd) and stoichiometry (n) . This method has revealed the differential binding affinities of Athe_0597 for various cello-oligosaccharides .

  • Molecular Dynamics Simulations: For understanding the conformational changes and mechanistic details of ABC transporters, molecular dynamics simulations have proven valuable . Such simulations have helped identify hinges and switches in the NBDs and the interfaces between subunits that are critical for the transport mechanism .

  • X-ray Crystallography: Crystal structures of ABC transporter components have established the consensus fold of the cassette and served as a basis for investigating the mechanochemistry through comparative analysis . While not specifically mentioned for Caldicellulosiruptor transporters, this approach has been fundamental in understanding related ABC transporters .

  • Growth Phenotype Analysis: Genetic deletion studies combined with growth measurements on different substrates provide functional validation of transporter specificity . This approach was used to confirm the role of the Athe_0595-0598 locus in cello-oligosaccharide transport .

How can researchers effectively distinguish between diverse ABC transporters in genomic and transcriptomic analyses of Caldicellulosiruptor species?

Distinguishing between diverse ABC transporters in genomic and transcriptomic analyses of Caldicellulosiruptor species requires a multifaceted approach that combines several complementary techniques:

  • Comparative Genomics: Analysis of gene clusters and conservation patterns across species can help identify functionally related transporters . The cello-oligosaccharide transporter locus (Athe_0595-0598) was found to be widely conserved across Anaerocellum and Caldicellulosiruptor genera, suggesting its fundamental importance .

  • Transcriptomic Analysis: Expression patterns under different growth conditions can reveal substrate-specific induction of particular transporters . For instance, constitutive expression of certain genes during growth on various sugars can indicate their central role in metabolism .

  • Functional Domain Analysis: Detailed examination of the protein domains can help classify transporters into functional families . ABC transporters typically contain characteristic NBDs with conserved motifs such as the LSGG region and Q-loop structures .

  • Substrate-Binding Protein Characterization: Since substrate-binding proteins often determine the specificity of ABC transporters, characterizing their binding properties can help distinguish between transporters with different functions . Biophysical methods like DSC and ITC are particularly valuable for this purpose .

  • Gene Deletion Studies: Systematic deletion of transporter components followed by phenotypic analysis can definitively link specific transporters to particular substrates . This approach was used to demonstrate that deletion of the msmK ATPase (Athe_1803) deactivates all oligosaccharide transporters in A. bescii .

What are the evolutionary implications of the conserved ABC transporter architecture across Caldicellulosiruptor and Anaerocellum genera?

The high conservation of the cello-oligosaccharide ABC transporter locus (Athe_0595-0598) across both Anaerocellum and Caldicellulosiruptor genera has significant evolutionary implications . This conservation suggests that the transporter system evolved early in the common ancestor of these thermophilic, cellulolytic bacteria and has been maintained due to its essential role in carbohydrate acquisition .

Several evolutionary aspects warrant consideration:

  • Functional Specialization: The presence of two distinct binding proteins (Athe_0597 and Athe_0598) with different substrate specificities suggests evolutionary diversification to optimize uptake of various degradation products . This specialization may represent an adaptation to efficiently utilize the complex mixture of oligosaccharides released during cellulose degradation.

  • Shared ATPase Utilization: The finding that multiple oligosaccharide transporters share a common promiscuous ATPase (Athe_1803) represents an interesting evolutionary adaptation . This arrangement potentially allows for more efficient energy utilization and simplified regulation compared to dedicated ATPases for each transporter.

  • Taxonomic Implications: The recent split between Anaerocellum and Caldicellulosiruptor genera makes the conservation of this transporter system particularly noteworthy . The differential conservation patterns between the two genera could provide insights into their divergent evolutionary trajectories and specialized ecological niches.

  • Horizontal Gene Transfer: The high conservation of this locus could alternatively be explained by horizontal gene transfer events between these thermophilic bacteria, rather than vertical inheritance from a common ancestor. Further comparative genomic analyses would be needed to distinguish between these possibilities.

What are the major challenges in maintaining protein stability during purification of recombinant Caldicellulosiruptor ABC transporter components?

Purifying recombinant Caldicellulosiruptor ABC transporter components presents several significant challenges due to their thermophilic origin and complex membrane association. Common issues include:

  • Protein Misfolding: When expressed in mesophilic hosts like E. coli, these thermophilic proteins may misfold due to temperature differences during expression . This can lead to inclusion body formation and reduced yields of functional protein.

  • Membrane Extraction: For permease domains that are integral membrane proteins, extraction from the lipid bilayer while maintaining native conformation is particularly challenging. Detergent selection becomes critical, as inappropriate detergents can denature the protein or fail to solubilize it effectively.

  • Complex Stability: ABC transporters function as multicomponent complexes, and isolating individual components may disrupt important stabilizing interactions . This is especially relevant for the permease domains that normally interact with both NBDs and substrate-binding proteins.

  • Post-translational Modifications: If glycosylation or other modifications are important for stability or function, expressing these proteins in systems that do not reproduce the native modifications may yield unstable products .

Solutions that have proven effective include:

  • Using specialized expression hosts adapted for membrane proteins

  • Employing solubility-enhancing fusion tags

  • Expressing thermophilic proteins at elevated temperatures

  • Implementing on-column refolding strategies

  • Using histidine tags for affinity purification, as successfully employed for CelA in C. bescii

  • Developing homologous expression systems in Caldicellulosiruptor species themselves

How can researchers effectively validate the substrate specificity of putative ABC transporter permease proteins?

Validating the substrate specificity of putative ABC transporter permease proteins requires a multi-faceted approach that combines genetic, biochemical, and biophysical methods. Based on successful strategies documented in the research:

  • Genetic Deletion Studies: Creating knockout mutants targeting the genes encoding permease components allows researchers to assess growth phenotypes on different substrates . The recent study with MACB1080 and HTAB187 strains demonstrated that deletion of the Athe_0595-0598 locus significantly impacted growth on cello-oligosaccharides, confirming its role in their transport .

  • Reconstitution in Proteoliposomes: While not explicitly mentioned in the provided literature for Caldicellulosiruptor transporters, reconstituting purified permease proteins with their associated NBDs in artificial membrane vesicles would allow direct measurement of substrate transport in a controlled system.

  • Binding Studies with Associated Binding Proteins: Since substrate specificity is often determined by the associated binding proteins, characterizing their interactions can provide indirect evidence of permease specificity . The differential binding of Athe_0597 and Athe_0598 to cello-oligosaccharides was effectively demonstrated using DSC and ITC methods .

  • Heterologous Expression: Expression of the complete transporter system in a heterologous host lacking endogenous transporters for the substrates of interest can provide functional validation of specificity.

  • Transport Assays: Direct measurement of substrate uptake using radiolabeled or fluorescently labeled substrates can definitively establish transport specificity and kinetics. This approach requires careful design to distinguish between binding and actual translocation.

What computational approaches can predict structure-function relationships in novel ABC transporter permease proteins?

Computational approaches offer powerful tools for predicting structure-function relationships in novel ABC transporter permease proteins from Caldicellulosiruptor species. Several effective methodologies include:

  • Homology Modeling: Using the growing number of solved ABC transporter structures as templates, researchers can build reasonably accurate structural models of novel permease proteins . These models can then inform hypotheses about substrate binding sites, conformational changes, and inter-domain interactions.

  • Molecular Dynamics Simulations: As demonstrated with the HisP protein, molecular dynamics simulations can identify critical hinges, switches, and interfaces in ABC transporters . Extending this approach to Caldicellulosiruptor permeases could reveal thermostability adaptations and functional mechanisms.

  • Machine Learning Approaches: Machine learning models have been developed to predict ABC transporter substrates based on physicochemical and structural properties . These approaches have achieved accuracy values of approximately 0.72 for general ABC transporter substrate prediction . Specialized models for thermal-adapted transporters could potentially improve prediction accuracy.

  • Sequence Conservation Analysis: Analyzing sequence conservation patterns across multiple Caldicellulosiruptor and Anaerocellum species can identify functionally important residues . The high conservation of the Athe_0595-0598 locus suggests functional importance of this transporter system .

  • Protein-Protein Interaction Modeling: Since ABC transporters function as complexes, modeling the interactions between permease domains, NBDs, and substrate-binding proteins can provide insights into the complete functional unit . The LSGG motif interaction with bound ATP, for example, has become a leading model for NBD dimerization .

What are the most promising applications of research on Caldicellulosiruptor ABC transporters in biotechnology?

Research on Caldicellulosiruptor ABC transporters offers several promising biotechnological applications, particularly in the context of lignocellulosic biomass conversion and thermostable enzyme development:

  • Enhanced Biofuel Production: Understanding and optimizing sugar transport systems in Caldicellulosiruptor species can lead to improved strains for consolidated bioprocessing of plant biomass into biofuels . By engineering more efficient transport systems, researchers could potentially increase the rate and yield of fermentation products.

  • Designer Microbial Consortia: Knowledge of the substrate specificities of different transporters could enable the design of synthetic microbial communities with optimized division of labor for biomass degradation and utilization . Different members could be engineered to specialize in particular substrates based on their transporter profiles.

  • Thermostable Protein Engineering: The structural adaptations that allow Caldicellulosiruptor ABC transporters to function at extreme temperatures (up to 78°C) provide valuable insights for engineering thermostability into other proteins . These principles could be applied to create robust enzymes for industrial processes.

  • Biosensor Development: The highly specific substrate-binding proteins associated with ABC transporters could be repurposed as components of biosensors for detecting specific oligosaccharides or other molecules of interest . Their thermostability would make them particularly valuable for applications requiring robust detection systems.

  • Novel Antimicrobial Targets: Comparative analysis of bacterial ABC transporters could reveal structural and functional differences that might be exploited for the development of new antimicrobial compounds targeting pathogenic species while sparing beneficial thermophiles.

What key knowledge gaps remain in our understanding of Caldicellulosiruptor ABC transporter permease function?

Despite significant advances, several critical knowledge gaps remain in our understanding of ABC transporter permease function in Caldicellulosiruptor species:

  • Structural Details: High-resolution structures of Caldicellulosiruptor permease proteins are currently lacking . Such structures would provide crucial insights into the adaptations that allow these proteins to function at extreme temperatures while maintaining the conformational flexibility necessary for transport.

  • Transport Kinetics: Detailed kinetic parameters for substrate transport by these ABC systems have not been thoroughly characterized . Understanding the rates, energy efficiency, and temperature dependence of transport would illuminate the adaptations specific to thermophilic transporters.

  • Regulatory Mechanisms: The mechanisms controlling expression and activity of different ABC transporters in response to substrate availability remain poorly understood . The signaling pathways that coordinate transporter expression with the production of extracellular carbohydrate-active enzymes are particularly important.

  • Post-translational Modifications: While glycosylation has been observed in some extracellular proteins of C. bescii, its occurrence and functional significance in membrane transporters remains unexplored . Understanding these modifications could be critical for successful heterologous expression and functional reconstitution.

  • Energy Coupling Efficiency: The efficiency with which ATP hydrolysis is coupled to substrate translocation, particularly at high temperatures, represents another knowledge gap . This coupling might differ from that of mesophilic transporters due to the thermophilic adaptations of these proteins.

Addressing these knowledge gaps will require integrated approaches combining structural biology, biochemistry, genetics, and computational modeling, with particular attention to the challenges posed by the extreme thermophilic nature of these organisms.

How might emerging technologies advance our ability to study ABC transporter permease dynamics in Caldicellulosiruptor species?

Emerging technologies offer exciting opportunities to advance our understanding of ABC transporter permease dynamics in Caldicellulosiruptor species:

  • Cryo-Electron Microscopy (Cryo-EM): Recent advances in cryo-EM have revolutionized structural studies of membrane proteins . This technique could capture different conformational states of the complete ABC transporter complex, providing insights into the transport mechanism at near-atomic resolution without the need for crystallization.

  • Single-Molecule Fluorescence Resonance Energy Transfer (smFRET): This technique can monitor conformational changes in real-time at the single-molecule level. Applied to Caldicellulosiruptor ABC transporters, it could reveal the dynamics of the transport cycle and how these are affected by temperature.

  • Advanced Molecular Dynamics Simulations: With increasing computational power, longer and more detailed simulations of membrane transporters are becoming feasible . These could model the effects of extreme temperatures on protein dynamics and reveal thermophilic adaptations in unprecedented detail.

  • Nanodiscs and Synthetic Membranes: These technologies provide controlled membrane environments for studying membrane proteins. They could be particularly valuable for reconstituting Caldicellulosiruptor transporters and examining how membrane composition affects their function at different temperatures.

  • CRISPR-Cas9 Genome Editing: Advances in genetic tools for thermophiles are enabling more precise genetic manipulation . This will facilitate the creation of targeted mutations to test hypotheses about permease function in vivo.

  • Artificial Intelligence and Deep Learning: These approaches could identify patterns in sequence, structure, and function relationships that might not be apparent through traditional analyses . They could potentially predict substrate specificities and functional properties of uncharacterized transporters based on primary sequence.

  • Native Mass Spectrometry: This emerging technique can analyze intact membrane protein complexes, providing insights into subunit stoichiometry, lipid interactions, and complex stability. It could reveal how Caldicellulosiruptor ABC transporter components assemble and interact in their native state.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.